KEGG   Candidatus Puniceispirillum marinum: SAR116_0636Help
Entry
SAR116_0636       CDS       T01207                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SAR116_0636
Enzymes [BR:apb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SAR116_0636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(676168..676830)
Genome map
AA seq 220 aa AA seqDB search
MAKNEDSKMQSNIIGRRGFMLVLSSPSGAGKTTIARRLIEEENGLYMSVSATTRPRRPGE
VEGKDYYFVEDETFHLMANRGEFLEHANVFDHYYATPAVPVMNALSEGRDILFDIDWQGT
QQIADKSRDDLVSVFILPPSTQDLEKRLLNRAQDSAEVVAKRMSKAADEISHYREYDYIL
VNENVDKAISDIKAIMVAERLKRDRQVGLTDFVKELRDQI
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaaatgaagattcaaagatgcaatcaaacattataggtcgtcgcggctttatg
cttgtcctttcatctccatcaggtgctggtaaaaccacaattgcacgacgtctgatcgaa
gaagaaaatggtctatatatgtccgtttcagcaacgacacgaccacgaagacctggtgag
gttgagggcaaggattattattttgtcgaggacgaaacttttcatttaatggccaatcgt
ggtgaatttttagagcatgccaacgtctttgatcactattacgccacgcctgcggtaccg
gtgatgaatgcgttgagtgaagggcgcgatattctgtttgatatagactggcagggtacc
cagcaaattgctgataaaagccgagatgaccttgtatcagtctttattctgcccccatcc
acccaagatctcgaaaaacgccttttaaaccgcgctcaggatagtgcagaagtggtcgcc
aaacgtatgtcaaaggcggcagatgaaattagccattatcgtgaatatgattatattctg
gttaatgaaaatgtcgataaagcgatcagtgatattaaggccatcatggtagccgaaagg
ctaaaacgtgatcgacaggtcggcctgactgattttgtcaaagaacttcgtgaccaaatt
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system