KEGG   Candidatus Puniceispirillum marinum: SAR116_0720Help
Entry
SAR116_0720       CDS       T01207                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:apb00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:apb00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(765324..765890)
Genome map
AA seq 188 aa AA seqDB search
MSETIIPAIQMTAVVAMAKNRIIGDGRGLLWHLRDDLKRVKALTMGCPLIMGRKTWDSIG
RPLPGRASIVMTRDPDWVAEGAYRVADISAAITASIDWINANEGAKLNIILFGGGEIYRQ
GLDYCTRIELTVVDLLPDGGTEPAYFPDFNMADWHQTIEADMPADAESPAFQYQTLTRPV
APRPLTTA
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaacgatcattccggctatccagatgaccgctgttgtggcgatggcaaaaaac
cgcatcattggtgatggtagaggtctgttgtggcatttgcgcgacgatttgaaacgcgtt
aaggcactgactatggggtgtccgctgattatggggcgtaaaacctgggactcgattggc
cggcctttgcctgggcgtgccagtatcgttatgacacgtgatccagattgggtcgccgaa
ggtgcgtatagggttgccgatatatctgcggctatcacggcctcaatcgactggatcaac
gctaatgaaggcgccaagcttaatatcattctatttggtggcggcgagatttatcgacaa
ggattggattactgcactcgaatcgaattgacagtcgttgatctgttacctgatggcggc
acagagcctgcctatttccccgacttcaatatggctgactggcaccaaaccatcgaagcg
gacatgcctgcagatgctgagtctccagcgtttcaatatcagacgctgacgcgtccagtc
gcgccgcgcccgctgacaacagcataa

DBGET integrated database retrieval system