KEGG   Candidatus Puniceispirillum marinum: SAR116_0720Help
Entry
SAR116_0720       CDS       T01207                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
apb00670  One carbon pool by folate
apb00790  Folate biosynthesis
apb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAR116_0720
   00670 One carbon pool by folate
    SAR116_0720
Enzymes [BR:apb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SAR116_0720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ADE38963
UniProt: D5BRR6
Position
complement(765324..765890)
Genome map
AA seq 188 aa AA seqDB search
MSETIIPAIQMTAVVAMAKNRIIGDGRGLLWHLRDDLKRVKALTMGCPLIMGRKTWDSIG
RPLPGRASIVMTRDPDWVAEGAYRVADISAAITASIDWINANEGAKLNIILFGGGEIYRQ
GLDYCTRIELTVVDLLPDGGTEPAYFPDFNMADWHQTIEADMPADAESPAFQYQTLTRPV
APRPLTTA
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaacgatcattccggctatccagatgaccgctgttgtggcgatggcaaaaaac
cgcatcattggtgatggtagaggtctgttgtggcatttgcgcgacgatttgaaacgcgtt
aaggcactgactatggggtgtccgctgattatggggcgtaaaacctgggactcgattggc
cggcctttgcctgggcgtgccagtatcgttatgacacgtgatccagattgggtcgccgaa
ggtgcgtatagggttgccgatatatctgcggctatcacggcctcaatcgactggatcaac
gctaatgaaggcgccaagcttaatatcattctatttggtggcggcgagatttatcgacaa
ggattggattactgcactcgaatcgaattgacagtcgttgatctgttacctgatggcggc
acagagcctgcctatttccccgacttcaatatggctgactggcaccaaaccatcgaagcg
gacatgcctgcagatgctgagtctccagcgtttcaatatcagacgctgacgcgtccagtc
gcgccgcgcccgctgacaacagcataa

DBGET integrated database retrieval system