KEGG   Candidatus Puniceispirillum marinum: SAR116_0742Help
Entry
SAR116_0742       CDS       T01207                                 

Definition
cytochrome c family protein (EC:1.10.2.2)
Orthology
K08738  
cytochrome c
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:apb00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:apb02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(785159..785536)
Genome map
AA seq 125 aa AA seqDB search
MRLKKVLFQLVLTISLCSFGTSAIADDVANGEKVFKRCKACHYADKEKNKTGPHLVNIIG
RKAGSIEGYKYSKAMRESGLIWDEATLTAYLKAPKKFLKGTKMVFAGLKKESDIQNVIAY
LKTQK
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgcggttaaagaaagttttgtttcaactggtattaactatttcgctctgttctttcggg
acatcagcaatagctgatgatgttgccaatggagaaaaagtgtttaagcgctgcaaggcc
tgccactatgccgataaagaaaagaataagacaggcccgcatcttgtcaatatcattggg
cgtaaagccggttcgatagaggggtataaatattcaaaggcgatgcgtgagtccggactt
atctgggatgaggccactttaacggcctatttaaaggcacctaaaaaattccttaaaggc
actaaaatggtgtttgcaggtctgaagaaggagtcagacattcaaaatgtgatcgcatat
ttgaaaacccaaaaataa

DBGET integrated database retrieval system