KEGG   Candidatus Puniceispirillum marinum: SAR116_1113Help
Entry
SAR116_1113       CDS       T01207                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAR116_1113
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAR116_1113
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SAR116_1113
Enzymes [BR:apb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SAR116_1113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1189207..1190616)
Genome map
AA seq 469 aa AA seqDB search
MQYISTRGNDGPLGFEDALLSGLARDGGLYLPTEWPRFSIDEIRSMQGLSYTELAGRIMA
PFCEGEIDQAELTSMARDAYAGFDDPAIAPLVKLNDNIHVLELFHGPTIAFKDYAMQFLA
RAFDRALQAHGKQAVILGATSGDTGSAALEAFQGRDAVDVFILFPEGRVSPVQQRQMTSV
DAPGVHAVAVPSDFDACQDIVKTLFNAHEFRDQVNLSAVNSINWARLMPQIVYYFSSALS
LGAPDIKVAFSVPTGNFGNVFAGYVAAQMGLPVERLIVASNQNDILTRFFESGTMQREAV
APSHSPSMDIQVSSNFERLLFELLGRDGNAVNEAMATFAKTGRFDVDASVLEEAHNIFAG
YRLDDAATIAEIRHSATIDHMVLDPHSAVGVGAARMALADGTIPAGVPVISLACAHPAKF
QDAVASATGETPALPTHLSDLMSRSEKQLFADATPDAVKALVLQEKRSI
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatatcagcacccggggcaatgacgggccgttaggctttgaagatgcgcttctg
agtgggcttgcgcgtgatggtgggctatatctgccaacggaatggccacgcttttctatc
gacgaaatccggtcaatgcaggggttgtcctataccgagctagcgggtcggatcatggca
cctttctgtgagggtgaaattgatcaggctgaactcacaagcatggcgcgtgacgcctat
gctgggtttgacgatccggcgatcgcccctttggtaaagctgaatgataacatccatgta
ttagagctgtttcatggcccaaccattgcctttaaagattatgcgatgcagtttctggcg
cgcgcttttgaccgcgccttgcaggcacatggcaagcaggctgttattttgggtgctacc
agtggcgatacaggttcggcggcgctagaggcttttcagggacgtgatgcggttgacgta
ttcattctgtttcctgaaggccgtgtttcaccagttcagcaacgtcagatgacatcggtg
gatgcgccaggtgtgcatgcggttgctgtgccaagtgattttgatgcgtgccaggatatt
gttaaaacgctgttcaacgcgcatgaattccgcgatcaggtaaatctgtcggcggttaat
tcgatcaattgggcgcgtttgatgccgcagatagtctattatttttcatcggcacttagc
ctaggcgcgccagatataaaagtcgccttttcggtaccaacaggtaacttcggcaatgtg
tttgccggctatgtagccgcgcagatgggtttgccagttgaacgcttgatcgtggcgtcg
aatcagaatgatattctaacgcgcttttttgaaagcggtacgatgcagcgcgaagctgtt
gccccatcacatagcccgtcgatggatattcaggtatcaagcaattttgagcggctgtta
ttcgaattgctggggcgtgatggtaatgcggtgaatgaggctatggctacatttgccaag
accggacgctttgatgttgacgcatcggtgctagaagaggcgcataatatatttgctgga
taccggcttgatgatgcagctacgattgctgaaatacgccatagcgcaactattgatcac
atggtgcttgatccgcatagtgcggttggagttggtgcggcgcgaatggcgctggccgat
ggcacaattccggcgggtgtaccggttatatcgctggcctgcgcgcatccggcaaaattt
caggatgctgtcgcctcggcaacaggcgaaacaccagctttgccgacgcatctgtccgat
ctgatgtcacggtctgaaaaacagctattcgccgatgccacaccagatgctgtaaaagcg
ctggtgttacaggaaaaacgcagcatatga

DBGET integrated database retrieval system