KEGG   Candidatus Puniceispirillum marinum: SAR116_1194Help
Entry
SAR116_1194       CDS       T01207                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:apb00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1277583..1279577
Genome map
AA seq 664 aa AA seqDB search
MSSASESHAQFPALGVCYYPEHWPEDMWEADAKAMVAAGISWVRIAEFAWSRIEPQRDNF
TWDWLDRAVKTLGDAGLKITMCTPTATPPKWLIDEMPDMIAIEADGTPRRFGSRRHYCFS
HLGYRAESRRITQAIAARYGQMDAVAAWQTDNEYGCHDTIYSYSAAAKAGFQAWLADHYG
TVAELNKAWGNVFWSMEVGDFSEVELPNLTVTEANPAHNLDFRRYSTAAVVTFNREQTDI
LRRLSPDRPIAHNYMGEFAQFDHRPVAADLDIASWDSYPLGMLQNMQSYPSANTERDQKT
YADCMRTGEPDFQAFHHDLYRGMGRLWIMEQQPGPVNWAKYNPVPRAGAVRMWSWEAIAH
GAELVSYFRWRQAPFAQEQMHAGLMLRNNEPAVGLAEAKQFASELDLLDGADTIQAPIAL
IHDYEADWISALDGQSDDFAYLPLMLDFYRAIRRHGGSVDIIGPHDDISGYALVIVPCLM
HVPDSLAHQIEHFDGQLLIGPRTGAKTIDFQLPKNLAPGPLASVTGVTITRVDAVPASQT
ISVSDDEILGNFKIWREHVTAQGTVLAMGEDGYPAVIKSNRTSYLAGWPDAALANNVISQ
AMQQAGITTHEMPGYLRVRQRGNKLIFVNYGDQMMTIPNSFSGTFILGMQDVPPAGVSIM
HVDS
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcagcatctgaatcacatgcacaatttcccgcgcttggcgtttgttattatcct
gaacattggccagaagatatgtgggaagctgatgctaaagccatggtcgcggcaggcatc
tcatgggtgcgtattgccgaatttgcatggtcacggatcgagccgcaacgcgataatttt
acatgggactggcttgaccgtgcggtaaaaacgctgggtgatgcgggtctgaaaattacc
atgtgcacgccaacagccaccccgccaaaatggctaattgatgaaatgccggacatgatt
gccatcgaagctgacggtaccccacgacgtttcggatcgcggcgtcattattgcttttcg
catcttggttatcgcgcagaatcacggcggatcacccaagccattgccgcgcgttatggc
caaatggatgctgttgccgcatggcaaactgacaatgaatatggctgtcatgacactatt
tattcctattcggcggcggcaaaggccgggtttcaggcatggctggctgaccattacggc
acagttgcagaactgaacaaagcatggggcaatgtgttctggtcgatggaagtcggtgat
tttagtgaggttgaactcccaaacctgactgtgaccgaagccaaccctgcgcacaatctt
gatttcagacgctatagcacggcggccgttgtcacctttaaccgtgaacagaccgatatt
ctgcgccgcttatcaccagaccgaccgatagcccataactatatgggtgaatttgcccag
tttgatcatcgacccgttgccgccgatcttgatattgcgtcatgggacagctatccgctt
ggtatgttgcagaatatgcaaagctatccaagcgccaataccgaacgtgatcagaaaacc
tatgctgattgtatgcggacaggcgaacccgactttcaggcttttcatcatgatctatat
cgcggcatggggcgattatggatcatggaacaacaaccggggccggtaaattgggcaaaa
tacaaccctgtgccacgggctggcgcggtgcgtatgtggagttgggaagccatcgcgcat
ggcgctgaactggtcagctatttccgctggcgacaggccccctttgctcaggaacagatg
catgctggcctgatgttgcgcaataatgaaccggctgtcggccttgccgaggcaaaacaa
tttgccagcgaacttgatctgctggacggcgctgacacaatacaagcgccgatcgcgctg
atacatgattatgaagctgactggattagcgcacttgatggccaaagtgatgattttgcc
tatctgcctttgatgttggatttttaccgtgccattcgccggcatggtggctcggttgat
atcattgggccgcatgatgatattagcggttatgcgctggttattgtgccctgtcttatg
catgtgccagatagcctagcgcatcagatagaacattttgacggacagcttttgataggt
ccacgcactggtgcgaagacaatcgactttcaactgcctaaaaatttagcacctggtccg
ctagccagtgtcactggcgttaccataacccgcgttgatgctgtgcctgcaagccagaca
atatccgtgtcagatgatgaaatattaggcaatttcaaaatctggcgtgaacatgtaaca
gcgcaaggcaccgtcctagcaatgggcgaagatggctatccagcagttataaaaagcaac
cgtacatcctatctggcgggatggcctgatgccgcgttagccaataatgttatcagccaa
gccatgcaacaagctggcatcacaacacatgaaatgcccggttatttgcgtgtccgccaa
cgtggcaacaaactgatttttgtcaattacggtgaccagatgatgaccattcccaatagt
ttttcaggcacattcattctgggcatgcaagatgttccccccgctggggtcagcatcatg
catgttgattcatag

DBGET integrated database retrieval system