KEGG   Candidatus Puniceispirillum marinum: SAR116_1196Help
Entry
SAR116_1196       CDS       T01207                                 

Definition
glycoside hydrolase family protein (EC:3.2.1.22 3.2.1.86)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SAR116_1196
  Lipid metabolism
   00561 Glycerolipid metabolism
    SAR116_1196
   00600 Sphingolipid metabolism
    SAR116_1196
Enzymes [BR:apb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SAR116_1196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1281717..1283045)
Genome map
AA seq 442 aa AA seqDB search
MIKITMIGAGSTVFMQNILTDVLLEDCFKNCHVALQDIDEKRLKTSQLVAEKISATVNAK
PTITATTDRRTALQGADFVIIMIQVGGYKPSTVIDFEIPATYGLTQTIADTLGVGGVMRG
LRTVPVLAEIARDMMDICPDALMLQYVNPMAINCLALSRMVPDLRYVGLCHSVQGTAIDL
ARDLGESIDDIEFECAGINHVAFYTKFAKRHADGRVEDLYPRLHKLIDGRNYGANYDGCT
NHVRYEMLRRLGYFVTESSEHFAEYTPWFIKNDQPELIKQFDIPINEYIRRCEDQIEKWD
AQEQALLSDSPIICEKSVEYAARIINAVVNDVPDTINGNVLNDGLIGNLPANACVEVPCI
VDKRGITPQSVDDLPPHLAAIMQSSINVQSLTVEAIITGKKEHVYHAVMMDPHTGAELNL
DQIWQMVDELLDAHAGWLPALR
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaattacgatgataggtgctggtagcaccgttttcatgcagaatatcctgacg
gatgtgttgctggaagactgttttaaaaactgccatgtggcgcttcaggacattgatgaa
aaacggttgaaaacctcgcaattagtggctgaaaaaatcagcgccacggtcaatgccaag
ccaacgataaccgcgacaacggatcgccgcacagcgctgcaaggtgcggattttgttatc
atcatgattcaggtcggtggctataaaccatccacggttattgattttgaaattccggcc
acatacggtctgacgcagactatcgccgatacattgggcgttggcggggtgatgcggggg
ttgcgaacagtgccggttctagccgaaattgcgcgtgatatgatggatatatgccctgat
gcgctgatgttgcaatatgtcaatccaatggcgatcaactgtctggctttgtcgcggatg
gtgcctgatttgcgttatgtcggtctatgccattcggttcagggcactgcgattgatctg
gcgcgcgacctaggtgagtccattgatgatattgaatttgaatgcgctggaataaaccat
gttgccttctataccaaatttgccaagcgccatgctgatggcagggtcgaggatctctat
ccacgtctgcataaattgattgatggccgaaattatggggcgaattacgatggttgtacc
aatcatgtacgctatgaaatgctaaggcggcttggctattttgtaaccgagtcatccgag
cattttgccgaatatacgccatggtttatcaagaatgaccagccggaactgatcaaacaa
tttgatattcccatcaatgaatatattcgtcgttgtgaagaccagatcgaaaaatgggat
gcgcaggaacaggcactattatcggatagccccattatatgtgaaaagtcggttgaatat
gccgcacgtatcataaatgcggtggtgaatgacgtgcctgataccataaatggcaatgtg
ttgaatgacggattgattggcaatttacccgccaatgcttgtgtcgaggtaccgtgtatt
gttgataaacggggtatcacaccgcagagtgttgatgatctgccgccgcatcttgccgca
atcatgcaaagcagtataaatgttcagtcgctaactgttgaagcgatcatcaccggtaaa
aaggagcatgtctatcacgcggtgatgatggatccgcataccggtgccgagctcaacctt
gatcagatatggcagatggttgatgagcttcttgatgcacatgctggttggttgccagct
ttgcgctaa

DBGET integrated database retrieval system