KEGG   Candidatus Puniceispirillum marinum: SAR116_1256Help
Entry
SAR116_1256       CDS       T01207                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAR116_1256
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAR116_1256
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAR116_1256
Enzymes [BR:apb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SAR116_1256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1375676..1376914
Genome map
AA seq 412 aa AA seqDB search
MPENKMNEASKNSFRNQPDDGGRFGIHGGRFVAETLMPLILEVEKSYNESRQDDSFAREL
LYYQQHYVGRPSPLYFAERLTAHFGGAKLYLKRDELNHTGAHKINNVLGQALLAKRMGKK
KIIAETGAGQHGVATATACALFDMECEVFMGEEDVRRQKPNVDRMRLLGAKIHPVTSGTG
TLKDAMNEALRFWVTNAETHFYIIGTVAGPHPYPQMVRDFQSVIGIEARTQIQEAEGRLP
DALIACIGGGSNALGLFHPFLDDEDVDIYGVEAAGKGISSGLHAASLTGGTPGILHGNRT
YLLQNDDGQIIDAHSISAGLDYPGIGPEHSWLHDIKRVNYVSATDDEALIAFQLCSRLEG
IIPALEPSHALAFTGTMIGDMDKDSIVILNMCGRGDKDLGAVLPILEELGRL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgccggaaaataaaatgaacgaagcaagtaagaattcttttcgtaaccagcccgatgat
ggtggccgttttggcatccatggtggacgctttgttgccgaaacgctgatgccgctgatt
ttagaggttgaaaagtcatacaatgaatcacggcaggatgattcatttgcccgcgaatta
ctttattatcagcaacattatgttggccgtccaagtccactatattttgccgagcggctg
accgcgcattttggtggcgcaaaactatatctaaagcgcgatgagcttaaccatacaggt
gcccataaaatcaataatgttctggggcaagccttgctggccaagcgtatgggcaaaaag
aaaattattgccgaaactggtgctggtcaacatggcgtagccacagcaactgcctgcgca
ctatttgatatggaatgcgaagtctttatgggtgaggaagatgttcgccgtcaaaagcct
aatgttgaccggatgcgtctgctgggcgctaaaattcatcctgtcacatctggtaccggc
acattaaaagacgccatgaatgaagctttgcggttttgggtgaccaatgcggaaacacat
ttctatattattggcacggttgcaggtccgcatccctatccccaaatggttcgtgatttt
cagtctgttatcggcattgaggctcgtacccaaattcaggaagccgaagggcggctacct
gacgcactgattgcctgtattggcggcggatcaaacgcgttgggcttgtttcatccgttt
ctggatgatgaagatgtagatatttatggtgtggaagcggctggcaaaggtatttcatct
ggcctgcatgcggcgtcactaaccggtggcacaccaggtattctgcatggcaaccgcacc
tatcttctgcaaaatgatgatggccaaattattgatgcgcattcgatttctgctggcctc
gattatccaggcattgggcctgaacattcatggttgcatgatataaaacgcgttaattat
gtcagcgctaccgatgatgaagcgctgatagcattccagctttgttcacggcttgaaggt
attattcccgcgctggaaccatcacatgcgcttgctttcacaggcacaatgattggcgac
atggataaggactcaatcgtaattctgaatatgtgtggacgcggcgacaaggatcttggt
gccgtacttcctattcttgaagagcttggcaggctgtaa

DBGET integrated database retrieval system