KEGG   Candidatus Puniceispirillum marinum: SAR116_1257Help
Entry
SAR116_1257       CDS       T01207                                 

Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAR116_1257
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAR116_1257
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAR116_1257
Enzymes [BR:apb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SAR116_1257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1376966..1377787
Genome map
AA seq 273 aa AA seqDB search
MTRRIETAFAKAKSADRGVLGVFITAGDPDLETSEKILHALADTGVDFIELGMPFSDPMA
DGPAIQAASLRALKAGMSLQKTLAMAKRFRAKNADIPIILMGYYNPIYIYGNDVFLKDAV
DAGVDGLILVDLPPEEDEELCIPAKQAGLSFIRLVTPTTNDKRLPTVLAEANGFVYYVSV
TGITGTKSAAADSIDTAYKRISNHTDLPIVTGFGIKTAKQAAEVAKLSDGAVVGSAVVDI
IASNLSQDGSGNDDIVRKVAAFVRELANAVSGK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtcgtatcgagacagcttttgccaaagcaaagtcagcagaccgaggcgtttta
ggcgtctttatcacggctggcgaccccgaccttgaaacatctgaaaaaatattgcatgcc
cttgcagatacgggcgttgattttatcgagttaggcatgcctttttctgatccgatggcg
gatggtccggccattcaggcggcgtcactacgggctttgaaagctggtatgagcttgcaa
aagacattggccatggccaaacggtttcgtgcaaagaatgctgacattccaatcattctg
atgggctattacaatcctatttatatttatggcaatgatgtctttttgaaggatgctgtc
gatgcaggtgtagatggtttaattctggttgatctgccgcccgaagaagatgaagagttg
tgcattcccgcaaaacaggctggtcttagctttatccgacttgtaacaccaacgacgaat
gataaacgtctgccaacggttctggccgaggccaatggctttgtctattatgtatcagtg
acaggcataacaggcaccaaaagtgccgctgctgactctatagacaccgcctataagcgg
attagcaaccacacagatttgccgattgtcacaggttttggtatcaagacagctaaacag
gcagcggaagttgcaaaattgagtgatggtgcggttgttggatcagccgttgttgatatt
attgccagcaatctttcgcaagatggtagcggtaatgatgatatcgtccgtaaagttgcc
gcatttgtgagggaacttgcaaatgctgttagcggtaagtag

DBGET integrated database retrieval system