KEGG   Candidatus Puniceispirillum marinum: SAR116_1282Help
Entry
SAR116_1282       CDS       T01207                                 

Definition
type III restriction protein res subunit (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
apb  Candidatus Puniceispirillum marinum
Brite
Enzymes [BR:apb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     SAR116_1282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1409264..1411975)
Genome map
AA seq 903 aa AA seqDB search
MAMHKDFPTSPHEILKPDVRWFPADETLRDTSYEKLMPPLVPELRQKVFEWRNNGYPDVS
DTSRTLLNWWFKTPHPIPHADGTIGNFEYYFAQRESVETVIYLHEFVKVKDKHDLLRFDT
RGVVPPKLIEETWRRYVVKMATGSGKTKTMSLLLAWSYFHKKYEEDSDLSKNFLVIAPNI
IVLDRLRTDFDGLKIFSEDPVLPDNGTDGRNWRSDFQLTLHIQDEVGPLNSNGNIFLTNI
HRVYDDKTPAPTAEDENSMDYFLGKKPQGKTTDSGVDLGRIIRDIDELVVINDEAHHIHD
SKLTWFKSIGDIHNKLKQKGSQLALQIDVTATPKHNNGAIFVQTIADYPLVEAITQNVVK
HPVLPDSPSRSKLSEKQSSVFTEKYGDYINLGVTEWRKVYPEHEKLGKKAVLFVMTDDTK
NCDAVAEYLETTFPEFKDAVLTIHTNRNGEISESASSKASKDELEKLRKQSNEIDSWSSP
YKAIVSVLMLKEGWDVRNVTTIVGLRAFAAPSNILPEQTLGRGLRRMYPGSSGEEYVSVV
GTEAFMDFVESIQTEGVELEKRAMGTGTEPVAPMIIEVEEDGGKDIDKLDIEIPVLTPRA
VREYKNLNDLDLDTLQFQISDYYQYSEEEQREIVFRDITTDEVTHTTVLDGAISTDYRSV
IGYFAQTILKDLRLYAAYDVLYPKVQEFVQDKLFGKFVDLEDANTLRNLSEPNASRTIFE
TFKSAINALTIRDTGNAEIRDSIKIRNVRPFVVKDQKNITAKKSVFNKIVGDSVLELRFA
QFLERVPDVVSYAKNYTQVNFKIDYIDATGNIANYIPDFLVKVSDTKTFVVETKGLEDLD
DPLKIKRLRQWCADVNASHSDVEFDFVYVDQEKFDRLTGADGRSQNELATFSDLVSSFTA
YKE
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgcataaagacttcccaacatcgccacatgaaattctaaaacctgatgttcgt
tggtttcctgcagatgagactttgcgtgacacatcttatgaaaaacttatgcctccattg
gtgcctgagttacgccaaaaagtctttgaatggcgcaataatggatatcctgatgtaagt
gataccagtagaacactgttgaactggtggttcaaaactccgcatccaattcctcatgct
gacggcactattggtaattttgaatattactttgcgcaacgtgagtctgttgagacggtt
atatatctgcatgaatttgtgaaggttaaggacaagcatgatcttttgcgttttgacact
cgcggggttgttccaccaaaattgattgaagagacatggcgacgctatgttgtaaaaatg
gcaacaggtagtggcaagacaaagaccatgagtcttctccttgcatggtcttattttcac
aaaaaatatgaagaagactccgatctttcaaaaaatttccttgtcatcgcaccaaacatt
atcgttctggatcgactcagaactgattttgatgggttgaagattttctctgaagatcct
gtgttacctgacaatgggactgacggacgaaactggcgcagtgattttcaactcactcta
catatccaagatgaggtcggtccgttaaattcaaacggcaatatttttcttaccaacatc
catcgcgtttatgatgacaaaacgccagcaccaactgctgaagatgaaaactcgatggat
tacttccttggtaaaaaaccacagggaaaaaccacagattcgggtgttgatttaggtcgc
attattcgtgatatcgatgaacttgtggtcatcaatgatgaagcgcatcacatccacgac
agtaaattgacatggttcaaatcgatcggtgacatccataacaaacttaaacaaaagggt
tcacaactggcgttgcaaatagatgtgactgcgacgcctaagcacaacaatggtgcgata
ttcgtgcaaaccattgcggattatccattggttgaagcaatcacgcaaaatgttgtgaaa
cacccagttcttccagactcacctagtcgctcaaaactatctgaaaaacaaagttcggtc
ttcactgaaaaatatggcgactacatcaatcttggtgtgactgagtggcgcaaggtctat
ccagagcatgaaaaacttggaaagaaagcagtcttgttcgttatgaccgacgacaccaag
aactgtgatgctgttgcagagtatctagaaaccacattccctgagttcaaagatgccgtt
ctgacaattcataccaatcggaatggtgaaattagcgaaagcgcctcatctaaagcgtct
aaagatgaattggaaaaacttagaaaacaatctaacgagatcgatagttggtcttccccc
tataaggcgattgtttcggttctgatgctcaaagaagggtgggacgtcagaaatgttaca
actatcgttggtctaagagcatttgctgcaccgtcaaatatcttaccagaacagacactt
gggcgcgggttaaggcgaatgtatccaggaagcagtggtgaagaatatgtgagtgtcgtt
ggcaccgaagcatttatggattttgttgagtccattcagacagagggcgtcgaacttgaa
aaacgggcaatgggaacaggcactgaacccgttgcaccaatgataattgaggttgaagaa
gatggcggcaaagatatcgacaagttagatattgaaattccagtcctcactcctcgtgct
gttcgcgagtataaaaatttgaatgatcttgatcttgatacccttcaatttcagatttca
gattattatcaatattctgaagaagagcagcgggaaatagtgtttcgagacataacaact
gatgaagttacacataccacagtattggatggtgcaatctcaacagactaccgcagtgtc
attggttattttgcacaaaccattctaaaggatcttcgtttatatgccgcctacgatgtt
ctgtatccaaaagtgcaggagtttgttcaggataaactatttggaaaatttgttgattta
gaagatgctaacacactccgtaatttgagcgaaccaaatgcatcgcgaacaatatttgag
acattcaaatcagcgatcaatgcactaaccatcagagatactggtaatgcagaaattcgt
gacagcataaaaattcgcaatgtccgtccatttgttgttaaggatcaaaagaacatcaca
gcgaaaaagtctgtcttcaataaaatcgttggtgatagcgtccttgagttacgatttgca
cagttcttggagcgtgtccctgatgtggtgtcctacgctaagaactacacacaagtaaat
ttcaaaattgactacattgatgcaactggaaacattgctaattacatcccagattttctg
gtgaaggtttctgacacaaagacattcgtagttgaaaccaaaggtcttgaggacttggat
gaccctctaaagattaagagactgcgtcagtggtgtgctgatgttaatgcatcgcattca
gatgtagagtttgatttcgtttatgtggatcaggaaaagttcgacagactaactggtgcg
gatggaagatcacaaaacgaacttgccaccttctcagaccttgtttcaagtttcactgct
tacaaggagtag

DBGET integrated database retrieval system