KEGG   Candidatus Puniceispirillum marinum: SAR116_1319Help
Entry
SAR116_1319       CDS       T01207                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
apb00340  Histidine metabolism
apb01100  Metabolic pathways
apb01110  Biosynthesis of secondary metabolites
apb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SAR116_1319
Enzymes [BR:apb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SAR116_1319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ADE39562
UniProt: D5BTG5
Position
complement(1459611..1460912)
Genome map
AA seq 433 aa AA seqDB search
MTARLDFNQADFEPQFAALLDSKRESDQDVADIVASILARVRNEGDAALLDLTAQFDHFQ
QDNVAALAISKAEMQSALDELDPTLRAALVTACDRIRAFHEKQVPDGFGGLDDDGVALAM
RYTPVDAAGLYVPGGKAAYPSSVLMNAIPAAVAGVERRVMVVPAPDGYVNPLVLAAAALA
DVTEVWRIGGAQAVAALAYGTQSIAPVDKIVGPGNAFVATAKRQVFGTVGIDSIAGPSEI
LVIADAQNDPEWIAADLLSQAEHDEAAQSIMITDDADFADAVDAAVAAMLPRLDRVAVAS
QSWADNGAIITVPDMAKMPELANRIAAEHLELALDDPEKWAGDIRHAGAIFLGRYTPEAI
GDYVAGPNHVLPTARTAKFSSGLGVVDFMKRTTLVGCDAASFAKIAPAGVKLANAEGLGA
HALSMTIRMTKPV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacagctaggctggatttcaatcaggctgattttgagccacaatttgccgcattgctt
gatagcaaacgcgagtcagatcaggatgttgctgatattgtcgcgtctattctggcgcgt
gtgcgcaatgaaggtgatgcagccttacttgatctaacggcacagtttgaccatttccaa
caagataatgttgccgcgctggcgatttcaaaagctgagatgcaatcagcacttgatgag
ttggatccaacattgcgcgccgcgctggtgacggcatgtgatcgtatccgtgcgtttcat
gaaaaacaggtgccggatggttttggcggccttgatgatgatggggttgcgctggcgatg
cgttatacgcctgttgatgccgcagggctttatgtgcctggtggaaaagcggcctatcca
tcatcggttcttatgaacgccattccggcggcggttgctggtgttgagcgccgcgtcatg
gttgtgcccgcacccgatggttatgttaatccattggtgctggcagcagcagcgctggct
gatgtaaccgaggtttggcgtattggtggcgcgcaggcggttgcggcattggcctatggt
acccagagcattgcgccggttgataaaattgttgggcctggcaatgcctttgtggccacg
gcaaagcggcaggtctttggaacggttggtatcgattctatcgcagggccatcggaaatt
ctggtgattgccgatgctcagaatgatcctgaatggattgcggctgatttattgtcccag
gccgagcatgacgaagcggctcaatcgatcatgatcactgatgatgcggattttgccgac
gctgttgacgccgccgttgcggctatgctgccccgtctggaccgggtggcagtagcaagc
caatcatgggcggataatggtgctattatcactgtgcctgatatggcaaagatgcctgaa
cttgccaaccgtattgccgccgagcatctggagctagcgctggatgatcccgagaaatgg
gctggagacattcgccatgctggcgctattttccttggtcgttacacgcctgaagcaatt
ggcgattatgttgctggccccaatcatgtgttgcccacagcgcgcacggcaaaattttcg
tctggtcttggtgtggttgatttcatgaagcgtacaactttggtagggtgtgatgcggca
agctttgccaaaatcgccccagcaggtgtaaaacttgccaatgccgaagggctcggcgca
catgctttgtcgatgacgatccggatgacaaagcccgtataa

DBGET integrated database retrieval system