KEGG   Candidatus Puniceispirillum marinum: SAR116_1319Help
Entry
SAR116_1319       CDS       T01207                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:apb01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:apb00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1459611..1460912)
Genome map
AA seq 433 aa AA seqDB search
MTARLDFNQADFEPQFAALLDSKRESDQDVADIVASILARVRNEGDAALLDLTAQFDHFQ
QDNVAALAISKAEMQSALDELDPTLRAALVTACDRIRAFHEKQVPDGFGGLDDDGVALAM
RYTPVDAAGLYVPGGKAAYPSSVLMNAIPAAVAGVERRVMVVPAPDGYVNPLVLAAAALA
DVTEVWRIGGAQAVAALAYGTQSIAPVDKIVGPGNAFVATAKRQVFGTVGIDSIAGPSEI
LVIADAQNDPEWIAADLLSQAEHDEAAQSIMITDDADFADAVDAAVAAMLPRLDRVAVAS
QSWADNGAIITVPDMAKMPELANRIAAEHLELALDDPEKWAGDIRHAGAIFLGRYTPEAI
GDYVAGPNHVLPTARTAKFSSGLGVVDFMKRTTLVGCDAASFAKIAPAGVKLANAEGLGA
HALSMTIRMTKPV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacagctaggctggatttcaatcaggctgattttgagccacaatttgccgcattgctt
gatagcaaacgcgagtcagatcaggatgttgctgatattgtcgcgtctattctggcgcgt
gtgcgcaatgaaggtgatgcagccttacttgatctaacggcacagtttgaccatttccaa
caagataatgttgccgcgctggcgatttcaaaagctgagatgcaatcagcacttgatgag
ttggatccaacattgcgcgccgcgctggtgacggcatgtgatcgtatccgtgcgtttcat
gaaaaacaggtgccggatggttttggcggccttgatgatgatggggttgcgctggcgatg
cgttatacgcctgttgatgccgcagggctttatgtgcctggtggaaaagcggcctatcca
tcatcggttcttatgaacgccattccggcggcggttgctggtgttgagcgccgcgtcatg
gttgtgcccgcacccgatggttatgttaatccattggtgctggcagcagcagcgctggct
gatgtaaccgaggtttggcgtattggtggcgcgcaggcggttgcggcattggcctatggt
acccagagcattgcgccggttgataaaattgttgggcctggcaatgcctttgtggccacg
gcaaagcggcaggtctttggaacggttggtatcgattctatcgcagggccatcggaaatt
ctggtgattgccgatgctcagaatgatcctgaatggattgcggctgatttattgtcccag
gccgagcatgacgaagcggctcaatcgatcatgatcactgatgatgcggattttgccgac
gctgttgacgccgccgttgcggctatgctgccccgtctggaccgggtggcagtagcaagc
caatcatgggcggataatggtgctattatcactgtgcctgatatggcaaagatgcctgaa
cttgccaaccgtattgccgccgagcatctggagctagcgctggatgatcccgagaaatgg
gctggagacattcgccatgctggcgctattttccttggtcgttacacgcctgaagcaatt
ggcgattatgttgctggccccaatcatgtgttgcccacagcgcgcacggcaaaattttcg
tctggtcttggtgtggttgatttcatgaagcgtacaactttggtagggtgtgatgcggca
agctttgccaaaatcgccccagcaggtgtaaaacttgccaatgccgaagggctcggcgca
catgctttgtcgatgacgatccggatgacaaagcccgtataa

DBGET integrated database retrieval system