KEGG   Candidatus Puniceispirillum marinum: SAR116_1417Help
Entry
SAR116_1417       CDS       T01207                                 

Definition
G-D-S-L family lipolytic protein (EC:3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SAR116_1417
Enzymes [BR:apb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SAR116_1417
   3.1.2  Thioester hydrolases
    3.1.2.-  
     SAR116_1417
Lipid biosynthesis proteins [BR:apb01004]
 Fatty acid synthase
  Component type
   SAR116_1417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1572169..1572852)
Genome map
AA seq 227 aa AA seqDB search
MVLNLGFINRYVRFFYQSVMILLFVFMAGFGFGLKQTVAADDVPVRILVLGDSLVAGHGL
PQGKAFPEMLQQALLQDGVAVSVINAGVSGDTTAGGLARLDWSLADNPDAAIIVLGGNDL
LRGLDPDATYRNLEAIINRFKAENMAVLLAGMQAPRNFGTDYVDDFDQVYTRLAARGDVV
FYPFFLDGVAMVPDLNLGDGMHPNEDGISEITKRIMPSVRALLAKTP
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgaatttgggctttatcaatcgttatgtgcgctttttttaccagtcggtaatg
atacttctgtttgtgtttatggctggctttggttttggcttgaaacagacggtagctgcg
gatgatgtgccggtgcgtattctggtgcttggtgactcgttggtggcaggccatggattg
ccgcaaggcaaggcgtttcccgagatgttgcagcaggcacttttgcaggatggcgttgcg
gtatcagtgatcaatgcaggcgtgtctggcgatacaacagcaggcggtttggcacggctt
gactggtcattggctgataatccagatgcggccatcatcgtgcttgggggtaatgatctg
ctccgtgggcttgaccctgatgccacctatcgcaatctggaggcgattatcaatcgcttt
aaggccgagaatatggccgtgcttctggcggggatgcaggcaccacggaattttggcacc
gattatgttgatgatttcgaccaggtctatacacgtcttgcggcacgcggtgatgtggtt
ttctatccgttttttcttgatggtgtggcgatggtgccggatttaaatctgggtgacggc
atgcacccaaatgaagacggaatcagtgagattaccaagcgtatcatgccatctgtgcgg
gcgttgctagctaaaacaccctga

DBGET integrated database retrieval system