KEGG   Candidatus Puniceispirillum marinum: SAR116_1486Help
Entry
SAR116_1486       CDS       T01207                                 

Definition
cytochrome C (EC:1.9.3.1)
Orthology
K08738  
cytochrome c
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SAR116_1486
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SAR116_1486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1641992..1642576)
Genome map
AA seq 194 aa AA seqDB search
MDELGFNKLFAGFIMAGLLMLAGAKLADVMVPHSDLAENAYQIEVPEASAVADAAPVDKG
PEPIMAMLADADIAAGEKLSKKCTACHVFNAGGAAKVGPALWNIVNAAKGAADGFSYSAA
MAGFGGAWDYAALNAFLAKPKAYMPGTKMNFVGLKKPSDRANMIAWLRQQADAPVALPSA
EDIAAETAANGTDS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggacgaattgggatttaacaaactctttgctggttttattatggcaggcttgttgatg
ctggcaggtgccaagctggcagacgttatggtgccgcatagtgatcttgctgaaaatgcc
tatcagatcgaggtgccagaagcatcggctgttgcagatgccgcgcctgttgataagggg
cctgagccgattatggcgatgctggcggatgctgatattgccgcgggtgaaaagctgtcc
aagaaatgcacagcgtgccatgtgtttaacgctggtggcgcggccaaggttggcccggca
ttgtggaatattgttaatgccgcaaaaggcgctgctgatggtttcagctattcagcggcg
atggcaggttttggtggcgcgtgggattatgccgcgctcaacgcctttctggcgaaacca
aaagcctatatgcctggcaccaagatgaattttgtcggcctgaagaagcctagtgatcgt
gcgaatatgatcgcctggcttcgtcagcaagcagacgctccggtcgccctgccaagcgcc
gaagatatcgcggcagaaacagcggcgaatggtaccgacagctaa

DBGET integrated database retrieval system