KEGG   Candidatus Puniceispirillum marinum: SAR116_1491Help
Entry
SAR116_1491       CDS       T01207                                 

Definition
recombination protein RecR (EC:1.1.1.262)
Orthology
K06187  
recombination protein RecR
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:apb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1646984..1647577
Genome map
AA seq 197 aa AA seqDB search
MDSSLENLIRRLGRLPGLGPRSARRAVLFLLKNRDRLMLPLAQELHDIARTVRPCVDCGN
LDTADLCHICRDDRRDKSRICVVEDVGDLWAMERAAVFRGRYHVLGGTLSALDGRGPDDL
AIDRLLRRAQAGEVVEIILALSATVDGQTTAHYIAEKLAPSNLDVTRLAHGVPVGGELDY
LDDGTLAQALKARAKMN
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggattcatcactggaaaatctgatccggcgtcttggccggcttcctggtcttggcccc
cgttcggcgcggcgtgcggtgctgttcctgttgaaaaaccgtgaccggttgatgttacca
cttgcccaggagttacatgatatcgcccgcaccgtgcgcccctgtgtcgattgcggtaat
cttgatacagccgatctgtgccatatttgcagggatgaccggcgcgataaaagccgtatc
tgtgttgttgaggatgttggcgacctctgggcaatggaacgtgcggcggtatttcgcggc
cgctatcatgttcttggtggcacattgagcgcacttgacgggcgcggccctgatgatctg
gctattgatcgattgctccgccgggcacaggctggcgaagttgttgagataattctggcg
ctatcggccactgtcgatggccagacaaccgcgcattatattgccgaaaaactggcacca
tccaatcttgatgtgacacggcttgcgcatggcgtgccagttggcggtgaacttgattat
ctggatgatggcaccttggcacaagccctcaaggcccgcgccaaaatgaactag

DBGET integrated database retrieval system