KEGG   Candidatus Puniceispirillum marinum: SAR116_1491Help
Entry
SAR116_1491       CDS       T01207                                 

Definition
recombination protein RecR (EC:1.1.1.262)
Orthology
K06187  
recombination protein RecR
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:apb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SAR116_1491
DNA repair and recombination proteins [BR:apb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SAR116_1491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1646984..1647577
Genome map
AA seq 197 aa AA seqDB search
MDSSLENLIRRLGRLPGLGPRSARRAVLFLLKNRDRLMLPLAQELHDIARTVRPCVDCGN
LDTADLCHICRDDRRDKSRICVVEDVGDLWAMERAAVFRGRYHVLGGTLSALDGRGPDDL
AIDRLLRRAQAGEVVEIILALSATVDGQTTAHYIAEKLAPSNLDVTRLAHGVPVGGELDY
LDDGTLAQALKARAKMN
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggattcatcactggaaaatctgatccggcgtcttggccggcttcctggtcttggcccc
cgttcggcgcggcgtgcggtgctgttcctgttgaaaaaccgtgaccggttgatgttacca
cttgcccaggagttacatgatatcgcccgcaccgtgcgcccctgtgtcgattgcggtaat
cttgatacagccgatctgtgccatatttgcagggatgaccggcgcgataaaagccgtatc
tgtgttgttgaggatgttggcgacctctgggcaatggaacgtgcggcggtatttcgcggc
cgctatcatgttcttggtggcacattgagcgcacttgacgggcgcggccctgatgatctg
gctattgatcgattgctccgccgggcacaggctggcgaagttgttgagataattctggcg
ctatcggccactgtcgatggccagacaaccgcgcattatattgccgaaaaactggcacca
tccaatcttgatgtgacacggcttgcgcatggcgtgccagttggcggtgaacttgattat
ctggatgatggcaccttggcacaagccctcaaggcccgcgccaaaatgaactag

DBGET integrated database retrieval system