KEGG   Candidatus Puniceispirillum marinum: SAR116_1497Help
Entry
SAR116_1497       CDS       T01207                                 

Definition
(GenBank) Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
apb00300  Lysine biosynthesis
apb01100  Metabolic pathways
apb01120  Microbial metabolism in diverse environments
apb01230  Biosynthesis of amino acids
Module
apb_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SAR116_1497
Enzymes [BR:apb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SAR116_1497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer DUF1581
Motif
Other DBs
NCBI-ProteinID: ADE39740
UniProt: D5BTZ3
Position
complement(1651737..1652915)
Genome map
AA seq 392 aa AA seqDB search
MDDVSYSVDLTQRLIRCPSVTPADAGALDVLVTELTALGFECTRLAFGDGDARIDNLFAW
LGNKAASGTETKHFCFAGHTDVVPVGDADAWQFDPFSGTLDQGNIYGRGASDMKGGIAAF
VGAVARLLARDSFDPAKGHAISLMITGDEEGDAVNGTVKMVEWVQEHGFVPDFCVVGEPT
NPDAVGDVIKNGRRGSLSCQLTVEGAQGHVAYPHLADNPFARLLDMLAPVNSCELDGGNA
FFDPSTANITSIDTNNPAGNVIPARAQARFNIRFNTEHTADSLIGWLEEHFTRVGGIWHA
DWRASAHPFLTEPGMLTDIMIAAISKVTGRDPQLSTSGGTSDARFITTLCPVAEFGLVGR
TMHKVDEHTAIADIDVLSAIYENMLASYFEAA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgtttcatattcggttgacctgacccaacgtctgatccgctgtccgtcggta
acaccggcagatgcgggcgcgcttgatgtgctggtgactgagctgacagcattgggattt
gaatgtacgcggctggcctttggtgatggcgatgcgcggatcgataatctgtttgcatgg
ttgggcaacaaagcggcatcggggacagagacaaaacatttctgtttcgccggtcatacc
gatgtcgtgccagttggtgatgccgatgcgtggcagtttgatccgttttcggggacgctt
gaccaaggcaatatctatgggcgtggggcgtcggacatgaaaggtggcattgcggcgttt
gttggcgccgtagcccgtttgctggcacgcgatagctttgatccagccaaaggccatgcc
attagcctgatgattaccggtgatgaagaaggtgatgccgtcaatggtacggttaagatg
gtcgaatgggttcaggaacacgggtttgttcccgatttttgcgttgttggtgagccgact
aatccggatgccgtcggggatgtgatcaagaatggtcgccggggtagcttgtcatgtcag
ctaaccgtcgaaggggcgcaaggtcatgttgcctatccgcatctggcggataatccattt
gcacgattactcgatatgctggcaccggtgaatagctgtgagctggatggcggtaatgcg
ttttttgatccctcaacagcgaatataacgtcgattgacacgaataatccggctggcaat
gtgataccggcgcgggcgcaagcgcgtttcaatatccgttttaacactgaacatacagca
gatagtttaattggctggctggaagaacattttacgcgtgttggcgggatatggcatgct
gactggcgggcgtcggcgcatccgtttttgaccgaaccaggcatgctgaccgatatcatg
atcgcggcaatcagcaaagtaacaggacgtgacccgcagctatccaccagtggcggaacg
tcggatgcgcggtttattacaacactatgccctgtggccgaattcgggctggttgggcgg
actatgcataaagttgacgagcatacggcaatcgcagatatagatgttttatcggccata
tatgaaaatatgctggccagttattttgaggcagcatag

DBGET integrated database retrieval system