KEGG   Candidatus Puniceispirillum marinum: SAR116_1533Help
Entry
SAR116_1533       CDS       T01207                                 

Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:apb00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1697438..1698208
Genome map
AA seq 256 aa AA seqDB search
MDLEILVGALEPVVRKAGAKIMEIHDQDPDTNFKSDGSPVTEADRAAEAIILPALAQLAP
DIVVISEENAASHSLKAPHRFFLVDPLDGTKEFLKRDGKGSFTVNIALIENRVPIMGVVY
APALDRLFSGIVGNGATEKSADISTALSIRTPPASGALAVASASHRDEATNQWLAEHDIA
NTISIGSSLKFCLVAAGEADVYPRFGPTMEWDTGAGDAVLRAAGGHMTHLDDSMFLYGKP
DYRNDAFIAWGGFKPS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggatttagaaatacttgtcggggctctcgaacctgtcgtccggaaagctggcgcaaag
atcatggagattcatgaccaagacccggatacgaattttaaaagcgatggctcacctgta
accgaagctgatcgtgccgccgaggccattattttgcctgcattagcccagctggcacca
gacatagttgtgatatctgaagaaaatgccgccagccatagcctgaaagcgccacacaga
ttctttcttgtcgatcccttggatggcaccaaagaatttttgaagcgtgatggtaaaggc
agtttcaccgtgaacatcgcgctcattgaaaatagggtgccaatcatgggcgttgtttat
gcaccagccctcgatcgtttatttagtggcattgttggcaacggcgctactgaaaaatct
gcagatatatctacagcactatctattcgcacgccgcctgccagcggcgccctagccgta
gcgagcgcatcgcatagagatgaagcaaccaaccaatggctagccgagcatgatatagcg
aacacaatatcaattggatcgtccttgaaattctgccttgttgcggcaggtgaggccgat
gtctatccacggtttggcccgacaatggaatgggataccggggctggtgatgcggtattg
cgcgccgctggtgggcatatgacgcatcttgatgacagcatgtttctatatggtaagcca
gattacaggaatgatgcctttattgcttggggtgggttcaagccttcatag

DBGET integrated database retrieval system