KEGG   Candidatus Puniceispirillum marinum: SAR116_1533Help
Entry
SAR116_1533       CDS       T01207                                 

Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SAR116_1533
Enzymes [BR:apb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SAR116_1533
Transfer RNA biogenesis [BR:apb03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    SAR116_1533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1697438..1698208
Genome map
AA seq 256 aa AA seqDB search
MDLEILVGALEPVVRKAGAKIMEIHDQDPDTNFKSDGSPVTEADRAAEAIILPALAQLAP
DIVVISEENAASHSLKAPHRFFLVDPLDGTKEFLKRDGKGSFTVNIALIENRVPIMGVVY
APALDRLFSGIVGNGATEKSADISTALSIRTPPASGALAVASASHRDEATNQWLAEHDIA
NTISIGSSLKFCLVAAGEADVYPRFGPTMEWDTGAGDAVLRAAGGHMTHLDDSMFLYGKP
DYRNDAFIAWGGFKPS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggatttagaaatacttgtcggggctctcgaacctgtcgtccggaaagctggcgcaaag
atcatggagattcatgaccaagacccggatacgaattttaaaagcgatggctcacctgta
accgaagctgatcgtgccgccgaggccattattttgcctgcattagcccagctggcacca
gacatagttgtgatatctgaagaaaatgccgccagccatagcctgaaagcgccacacaga
ttctttcttgtcgatcccttggatggcaccaaagaatttttgaagcgtgatggtaaaggc
agtttcaccgtgaacatcgcgctcattgaaaatagggtgccaatcatgggcgttgtttat
gcaccagccctcgatcgtttatttagtggcattgttggcaacggcgctactgaaaaatct
gcagatatatctacagcactatctattcgcacgccgcctgccagcggcgccctagccgta
gcgagcgcatcgcatagagatgaagcaaccaaccaatggctagccgagcatgatatagcg
aacacaatatcaattggatcgtccttgaaattctgccttgttgcggcaggtgaggccgat
gtctatccacggtttggcccgacaatggaatgggataccggggctggtgatgcggtattg
cgcgccgctggtgggcatatgacgcatcttgatgacagcatgtttctatatggtaagcca
gattacaggaatgatgcctttattgcttggggtgggttcaagccttcatag

DBGET integrated database retrieval system