KEGG   Candidatus Puniceispirillum marinum: SAR116_1669Help
Entry
SAR116_1669       CDS       T01207                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAR116_1669
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAR116_1669
   00630 Glyoxylate and dicarboxylate metabolism
    SAR116_1669
Enzymes [BR:apb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SAR116_1669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1842485..1844725)
Genome map
AA seq 746 aa AA seqDB search
MMRRFGRNRTFVFTCPFYVEIMMIAFDTHGHLSIASPLYQFVNTMLTEQGLMTPDAFWSG
FDKAVHELAPRNRALLAKRESIQTQIDAWHNTHAGSAIDATAYETFLRDIGYLVPEVADF
QVETTNVDAEIASIAGPQLVVPITNARYALNAANARWGSLYDALYGTDVIPHDDKDGITK
AYNPLRGAKVIAYVRKVLDDAVPLASGSWSDVTRLVITNGAFDITLTSGASTQLANKAGF
AGYTGDPATPSSVILCNNGLHFQIMIDADGVIGQDDPASINDVRGESALSTIMDCEDSIA
AVDAEDKVVAYSNWYGLMNGSLQDTFEKGGKTIVRKLNNDIDYVTANGESASLRGRALML
VRNVGHLMTNPAIMLSDGSEIPEGIMDAFITVAAAMSDLQARRNSVAGSVYIVKPKMHGP
EEVAFANDIFAAVEDVLGLPPFTIKMGIMDEERRTTVNLKACINAAKNRVVFINTGFLDR
TGDEIHTSMNAGPMIRKSDMKAAPWIAAYENWNVDIGLACGLGGRGQIGKGMWAMPDMMA
AMMEQKIGHPMAGANCAWVPSPTAATLHALHYHQVNVAEQQAKLATREPAKRADILSIPI
STRPNWSADDIRQELRNNAQGILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQH
MSNWLHHGICDDALVMEVMQEMAAIVDQQNAGDPAYTPMAGNFDNSIAFKAACDLVFQGR
EQPSGYTEPVLHRRRLEKKLSDRADA
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgccgctttggtcgcaaccgcacatttgttttcacctgtcctttctatgtggag
ataatgatgatcgcctttgatacgcatggacatctttcgattgccagcccgctttatcaa
tttgtaaataccatgctgaccgagcaggggctgatgacacctgatgccttctggtctggc
tttgacaaggcggttcatgaattggcaccacgtaatcgggcattgcttgccaagcgcgaa
tcgattcaaacccagattgacgcctggcataatacgcatgctggcagtgctattgatgca
actgcctatgagacctttctgcgtgatattggctatcttgtgccagaggtcgccgatttt
caggttgaaaccacgaatgtcgatgccgaaatcgcatctatcgctgggccacagctggtc
gtgccgatcaccaatgcccgctacgcgttgaacgcggcgaatgcccgctggggcagcctt
tatgatgccctatatggtactgacgtgatcccgcatgatgacaaagatggcataaccaag
gcctacaaccccctgcgcggggcaaaggtcatcgcctatgtgcgcaaggtgcttgatgat
gccgtgcctttggcgtctggttcatggtctgatgtcacacgtctggtgatcaccaatggc
gcgtttgacataacgcttacctcgggcgcctcaacccagcttgctaataaggctggcttt
gctggctatactggcgatccggcaaccccttcatcggtcattctgtgcaataacggtttg
catttccagatcatgatcgatgccgatggcgtcattggtcaggatgatccggcatccatc
aatgatgtgcgcggcgagtccgccttatcaacgatcatggattgtgaagattcaatcgcc
gctgtcgatgccgaagataaagttgttgcctacagcaactggtacggcctgatgaatggt
agccttcaagacacctttgaaaagggcggcaagaccatcgtccgcaaactgaataatgat
atcgactatgtcaccgccaatggcgaaagcgccagcctgcgcggacgcgcattgatgctg
gtgcgtaatgtcggccatctgatgaccaatccggcgatcatgctgtctgacggcagtgaa
attccggaaggcatcatggatgcctttatcaccgttgccgccgccatgtcagatttgcag
gcacgtcgcaattcggtcgctggatcggtttatatcgtgaagccgaaaatgcacgggccc
gaagaagtcgcctttgccaatgatattttcgccgcggttgaagatgtgctgggattgccg
cctttcaccatcaaaatgggcatcatggatgaggaacgccgtacaacggtcaatctcaaa
gcctgcatcaatgccgccaaaaaccgggttgtctttattaataccggtttcctcgaccgc
accggtgacgagattcacacctcgatgaatgccggtccgatgatccgcaaaagcgatatg
aaagcggcgccatggatcgccgcctatgaaaactggaatgtcgatatcggccttgcctgc
ggcttgggtggacgtggccagattggcaagggcatgtgggcaatgcccgatatgatggcc
gccatgatggaacagaaaatcggtcatccgatggcgggggcaaattgtgcatgggtgcca
tcacccaccgccgctactttacacgcattgcattatcatcaggtcaatgtcgccgaacag
caagctaaactggcaacacgcgaacctgccaaacgcgccgatattctgtcgatcccgatc
agcacaagaccaaactggtctgctgatgatatccgtcaggaactgcgcaataacgcccag
ggcattcttggctatgttgtgcgctggatcgatcagggcgttggctgttcaaaagtgccc
gatatccatgatgtcggcctgatggaagaccgcgcaaccttgcgcatttcatcccagcat
atgagcaactggctacatcatggcatttgtgacgatgcgctggtgatggaggtaatgcag
gaaatggccgccatcgtcgatcagcaaaatgcaggcgatccggcctatacgccaatggcg
ggcaattttgacaattcgatcgctttcaaagctgcctgtgatctggtatttcaggggcgc
gaacagccttcgggctataccgagccggtattgcatcgccgccgccttgaaaagaaacta
agtgatcgggcagatgcttaa

DBGET integrated database retrieval system