KEGG   Candidatus Puniceispirillum marinum: SAR116_1827Help
Entry
SAR116_1827       CDS       T01207                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAR116_1827
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAR116_1827
   00650 Butanoate metabolism
    SAR116_1827
  Energy metabolism
   00190 Oxidative phosphorylation
    SAR116_1827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2025856..2026221
Genome map
AA seq 121 aa AA seqDB search
MVKNSDKTMPRPRVSGLSHWRWQRMSAVAVLMLMAYFVFVVTRIGTLDYAAARAFLATPY
QALALALLVVIGVFHGTLGAHVVIEDYVPVKSGRHALILTVSIIMAIIAGASLIAIASVA
F
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaattcagacaaaacaatgccaagaccacgggtttccggattgtcgcattgg
cgctggcaacggatgagcgctgtcgctgttttgatgttgatggcctattttgtgtttgtt
gtgacacggattggcactttggattatgcagcggcgcgcgcctttttagcaacgccctat
caggcattggcgctggcattgctggttgtgatcggggtgtttcatggcactttgggcgcc
catgtcgttattgaggattacgtacccgtgaaatctggacgtcatgctcttatattaaca
gtgagtatcataatggcgattattgcgggggcgagtttaatagcgattgcgtcagtagcc
ttttag

DBGET integrated database retrieval system