KEGG   Candidatus Puniceispirillum marinum: SAR116_1832Help
Entry
SAR116_1832       CDS       T01207                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAR116_1832
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAR116_1832
   00640 Propanoate metabolism
    SAR116_1832
   00660 C5-Branched dibasic acid metabolism
    SAR116_1832
Enzymes [BR:apb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SAR116_1832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2031227..2032387
Genome map
AA seq 386 aa AA seqDB search
MNIHEHQAKQLLGGFGVPVPRGNAVFSVDDAVSAATELGGPVYVVKAQIHAGGRGKAGGV
KVVKSVDAVRDAADDILGKVLVTHQTGPEGREVRRLYVEDGCDIASELYISLLVDRASSR
VTIIASSEGGMDIEEVAANQPDKIISLGIDPATGLQPHHVRRIARVLGLEGTTAKQLPSF
LASLYKAFGDLDASLIEINPLVVTGAGDLLALDAKMSFDDNALYRHKDVQELRDLTEEDP
AEVKASEFDLNYIKLDGDIGCMVNGAGLAMATMDIIQLHGASPANFLDVGGGATTEKVTE
AFKIILTDDNVKGILVNIFGGIMRCDIIAEGVVMAARNLGLTKPLVVRLEGTNVAEGKKI
MAESGLDIIPADDLADAAAKIVAAIK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaacatcaggcaaaacagcttcttggtggttttggtgtgccagtgcca
cgtggcaatgcggtattttccgttgatgatgccgttagtgcagcaactgagcttggcggt
cctgtctatgtcgttaaggcgcagatccatgctggtgggcggggcaaggccggcggcgtc
aaagttgtaaaatctgtcgatgctgtccgcgatgcggctgatgacattctgggcaaggtt
ctggtgacgcatcagactggccccgaaggtcgcgaagtacgtcggctttatgttgaagat
ggctgtgatattgccagtgaattatatatttccctgctggttgaccgcgcgagtagccgc
gtgacaattatcgcatcaagcgaaggcggcatggatatcgaagaggttgccgcgaaccag
ccggacaagattatttcacttggcatcgatccggcaacaggcttgcagccgcatcatgta
cgtcgcattgcccgtgtgctgggtcttgaaggcacaacagcaaagcagttaccaagcttt
ctggcatcactttacaaagcctttggtgatcttgacgccagcctgatcgagattaacccg
ctggtggttaccggtgctggcgatctgctggcgcttgatgcgaaaatgagctttgacgat
aatgcgctttaccggcacaaggatgtgcaggaactgcgtgacctgactgaagaagatcca
gccgaagtcaaagcctccgaatttgacctcaactatatcaagcttgatggcgatatcggt
tgtatggtcaatggtgcaggtctggcgatggcgacgatggatatcatccagcttcatggt
gcttcaccagccaattttctggatgttggcggtggtgccacaaccgaaaaggtcaccgaa
gcgttcaagatcattctgactgacgataatgtgaaaggtattctggtgaatatctttggc
ggtatcatgcgctgcgacatcattgccgagggtgttgtgatggcggcgcgtaatctgggg
ctgaccaagccgctggttgtccggcttgaaggcaccaacgtagccgaaggcaaaaaaatc
atggccgagtcaggtcttgatatcattccagccgatgatcttgcggatgccgccgccaag
attgttgcagctatcaaataa

DBGET integrated database retrieval system