KEGG   Candidatus Puniceispirillum marinum: SAR116_1835Help
Entry
SAR116_1835       CDS       T01207                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
apb00020  Citrate cycle (TCA cycle)
apb00310  Lysine degradation
apb01100  Metabolic pathways
apb01110  Biosynthesis of secondary metabolites
apb01120  Microbial metabolism in diverse environments
apb01130  Biosynthesis of antibiotics
apb01200  Carbon metabolism
Module
apb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAR116_1835
  Amino acid metabolism
   00310 Lysine degradation
    SAR116_1835
Enzymes [BR:apb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SAR116_1835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H Mur_ligase SAPS
Motif
Other DBs
NCBI-ProteinID: ADE40078
UniProt: D5BMN5
Position
2036342..2037595
Genome map
AA seq 417 aa AA seqDB search
MATDIIVPTLGESVSDATIARWIKKAGDTVAADEPVVELETDKVTLEVPSPVAGKLSELV
VAEGDTVEVGAVLARVEAGKGARAAADKAEPAKAEQAKAPEAKAEAIPADKVPTASKADA
HPLSPAVRRLVEENNLNPASIVGTGVDGRLTKADVLAAMKAPTAPTAPAQVASQTPRQTP
REIDAAREERVPMSKLRRVIAGRLKEAQNNAAMLTTFNEVDMTELMALRASYRTEFENTH
QVRLGFMGMFVQASVMALREFPAVNAEIDGNDIIYKNYYNIGVAVGTPQGLVVPVIKGAE
AMNLAEVERTIGDFGMRARDGKIAPDDMAGGTFTISNGGVYGSLMSTPILNPPQSGILGM
HKIEKRAVVVDDAIVIRPMMYLALSYDHRIIDGREAVSFLARVKDLVEDPRRLLIGV
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgatattattgtcccgactctaggcgaatctgttagcgacgcaacgattgca
cgctggatcaaaaaagcaggtgatacggtagccgccgacgaacccgtagttgaactggag
accgataaggtgacgctggaagtgccctcgcctgtagctggcaagctaagcgaattggtc
gtggctgaaggtgatacggtcgaagttggcgctgtattggcacgcgttgaagccggcaaa
ggcgcacgcgctgccgcagataaagctgagccggcaaaagccgagcaagccaaggcaccg
gaagctaaagccgaagccataccggcagataaagtcccgaccgcatccaaggccgatgcg
catccgttgtcgccagccgtacgccgccttgttgaggaaaataatctgaacccggccagc
attgttggtacgggtgttgatggccgtctgacaaaagccgatgtgctggcggcgatgaaa
gcgccaacggcaccaacggcaccagcacaagtagcaagccagacaccacggcaaacaccg
cgcgagattgatgcggcgcgtgaagagcgtgtgccgatgtcgaaattgcggcgggtgatc
gcagggcgtctgaaagaagcacagaataacgcggcgatgctgaccacattcaacgaagtc
gatatgaccgaacttatggcattgcgggcaagttacagaactgaatttgaaaatacccat
caggtgcggcttggcttcatgggtatgtttgtgcaggcgtcggttatggcgttgcgggaa
tttccggcggtcaatgccgaaatcgacggtaacgatatcatctataagaactattataat
atcggtgttgctgtgggcacgccgcaaggacttgtggtgccagtcatcaaaggtgccgag
gcgatgaatctggctgaggttgaacgcacaatcggtgattttggcatgcgagcacgtgac
ggtaagattgcgccagacgatatggcaggtggcacctttaccatatcgaatggaggtgtt
tatggatctttgatgtcgacaccaattctgaatccgccgcaaagtggaatattggggatg
cataaaattgaaaagcgggcggttgtggtcgatgatgccatcgtgatcagaccaatgatg
tatctggcgctatcttatgaccaccggatcattgacggccgtgaggcggtttcatttctc
gcccgggttaaggatctggttgaggatccacggcgtctgttgattggtgtttaa

DBGET integrated database retrieval system