KEGG   Candidatus Puniceispirillum marinum: SAR116_1835Help
Entry
SAR116_1835       CDS       T01207                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAR116_1835
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAR116_1835
  Amino acid metabolism
   00310 Lysine degradation
    SAR116_1835
Enzymes [BR:apb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SAR116_1835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2036342..2037595
Genome map
AA seq 417 aa AA seqDB search
MATDIIVPTLGESVSDATIARWIKKAGDTVAADEPVVELETDKVTLEVPSPVAGKLSELV
VAEGDTVEVGAVLARVEAGKGARAAADKAEPAKAEQAKAPEAKAEAIPADKVPTASKADA
HPLSPAVRRLVEENNLNPASIVGTGVDGRLTKADVLAAMKAPTAPTAPAQVASQTPRQTP
REIDAAREERVPMSKLRRVIAGRLKEAQNNAAMLTTFNEVDMTELMALRASYRTEFENTH
QVRLGFMGMFVQASVMALREFPAVNAEIDGNDIIYKNYYNIGVAVGTPQGLVVPVIKGAE
AMNLAEVERTIGDFGMRARDGKIAPDDMAGGTFTISNGGVYGSLMSTPILNPPQSGILGM
HKIEKRAVVVDDAIVIRPMMYLALSYDHRIIDGREAVSFLARVKDLVEDPRRLLIGV
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgatattattgtcccgactctaggcgaatctgttagcgacgcaacgattgca
cgctggatcaaaaaagcaggtgatacggtagccgccgacgaacccgtagttgaactggag
accgataaggtgacgctggaagtgccctcgcctgtagctggcaagctaagcgaattggtc
gtggctgaaggtgatacggtcgaagttggcgctgtattggcacgcgttgaagccggcaaa
ggcgcacgcgctgccgcagataaagctgagccggcaaaagccgagcaagccaaggcaccg
gaagctaaagccgaagccataccggcagataaagtcccgaccgcatccaaggccgatgcg
catccgttgtcgccagccgtacgccgccttgttgaggaaaataatctgaacccggccagc
attgttggtacgggtgttgatggccgtctgacaaaagccgatgtgctggcggcgatgaaa
gcgccaacggcaccaacggcaccagcacaagtagcaagccagacaccacggcaaacaccg
cgcgagattgatgcggcgcgtgaagagcgtgtgccgatgtcgaaattgcggcgggtgatc
gcagggcgtctgaaagaagcacagaataacgcggcgatgctgaccacattcaacgaagtc
gatatgaccgaacttatggcattgcgggcaagttacagaactgaatttgaaaatacccat
caggtgcggcttggcttcatgggtatgtttgtgcaggcgtcggttatggcgttgcgggaa
tttccggcggtcaatgccgaaatcgacggtaacgatatcatctataagaactattataat
atcggtgttgctgtgggcacgccgcaaggacttgtggtgccagtcatcaaaggtgccgag
gcgatgaatctggctgaggttgaacgcacaatcggtgattttggcatgcgagcacgtgac
ggtaagattgcgccagacgatatggcaggtggcacctttaccatatcgaatggaggtgtt
tatggatctttgatgtcgacaccaattctgaatccgccgcaaagtggaatattggggatg
cataaaattgaaaagcgggcggttgtggtcgatgatgccatcgtgatcagaccaatgatg
tatctggcgctatcttatgaccaccggatcattgacggccgtgaggcggtttcatttctc
gcccgggttaaggatctggttgaggatccacggcgtctgttgattggtgtttaa

DBGET integrated database retrieval system