KEGG   Candidatus Puniceispirillum marinum: SAR116_1962Help
Entry
SAR116_1962       CDS       T01207                                 

Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:apb00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2166453..2168414
Genome map
AA seq 653 aa AA seqDB search
MCGIAGFFDQKGFDATAGTQLAKDMAKAIIHRGPDDAGVWVDDAAGIALAHRRLSIVDLS
AAGHQPMLSASGRYVLAYNGEIYNHTELRNALEASGKGYDWRGHSDTETALACIEAYGLE
AALQQFVGMFALALWDKQEKALYLARDRIGEKPLYFGRHNNIWLFGSELKALRVHHEFTS
AINRDALCLYLRHNYIPAPYSIYDGIGKLPPGSYVRLDAHTIDAAPVPFWTLDDKVSNGK
ANAFDGSEAEALDHLDKVLSRAVRLQMQADVPLGAFLSGGVDSSLIVALMAEQSERKVKS
FSIGFEDAQFDEAPFARDVANHIGTDHHELYVTAQETLDVIPKLPMLYDEPFSDSSQIPT
FLVSQIARQHVTVSLSGDAGDELFGGYNRYTWGRSIWNKMNKVPHPLRSAMGTGIGMLSP
KAWNAIMVPLMNMVPQKYQQKNPGDKLHKAAGMFSAKAPEDIYKYLVSHWPDPAAIVLGG
TEPQTTLTSSHDVMDDMPFEARMMYLDMLSYLPDDILVKVDRAAMGVSLETRVPFLDHNV
VEAAWQLPMNMKIRNGTGKWCLRELLYRRVPKHLIERPKMGFGVPLDAWLRGPLRDWAEH
LLDEKRLAQAGFFDPAPIRKKWDEHLSGARSWHYYIWDILMFEAWRDEQGGCG
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattgccggattttttgaccagaagggttttgatgccactgctgggacgcag
cttgccaaagatatggcaaaagcaattatccatcgtgggcccgatgatgccggcgtttgg
gttgatgatgccgctggaatagcgctcgcgcatagacgcctttcgattgttgatctgtct
gccgctgggcatcaaccaatgttgtcagcatccggtcgctacgtgcttgcgtataatggg
gaaatttacaatcatacagaattacgaaacgcattagaggcgtcaggtaaaggatacgac
tggcgtgggcactcagacaccgaaacggcgcttgcctgtatcgaggcctatgggctggaa
gcagccttgcagcaattcgttggtatgtttgcgcttgccctctgggataagcaggaaaaa
gcattatacctagcgcgtgatcgcattggcgaaaagccactttattttggtcgtcataac
aacatctggctatttggatcagagctaaaggcgcttcgcgtccatcacgaatttacctct
gctattaaccgtgatgctttatgcctttatctacggcataattatattccagctccatat
tcgatttacgatggcataggtaaattgccgcctggatcatatgtccggctggacgcgcat
acaattgatgctgctcccgttcctttttggacacttgatgataaggtctctaatggcaag
gctaatgcttttgatggttctgaagctgaggcgcttgatcatctggataaagtactttcc
cgtgcggtcaggttgcaaatgcaagcagatgtccctttgggggcgtttctgtcaggtggt
gttgactcatcactaatcgtcgcgttgatggccgaacaaagcgaacgaaaagtaaaatct
ttttcaatagggtttgaggatgcgcagtttgatgaagcgccatttgctagggatgtggcc
aatcatataggcacagaccatcatgagctttacgttacggcacaggaaactttggacgta
atacccaagctaccaatgctttatgatgagccattctctgactcatcacagataccaact
ttcctagtgtcacaaattgcccgccagcatgttaccgtgtcactttcaggcgatgctggc
gacgaattatttgggggttacaatcgctatacatgggggcgttctatctggaataagatg
aacaaagtacctcatcctttgcgttcggcaatgggaaccggtatcggtatgctgtctccc
aaagcatggaatgctatcatggtgccgctaatgaatatggtgccacaaaaatatcaacag
aaaaatccgggggataaactgcataaggccgcaggcatgttttcggccaaagcacccgaa
gatatttataaatatctggtttcgcactggcctgatccggctgcgattgtgcttggcggg
actgaacctcaaactaccctgacctcatcacatgatgtgatggatgatatgccgttcgag
gcgcggatgatgtatcttgatatgctgagttatttgccagacgatattcttgtaaaagtt
gatcgagccgctatgggtgtgtcgctggaaacgcgcgttccatttctggatcacaatgtg
gttgaggccgcatggcagttacctatgaatatgaaaatccgtaatggcaccggtaaatgg
tgcttgcgagagcttttatatcgccgggtaccaaaacatcttattgagcggccaaagatg
gggtttggcgtgcctctcgatgcgtggttgcgaggacctttgcgtgactgggccgaacat
ctgcttgatgaaaaacgtttggcacaggccggattttttgaccctgcccccattcgcaaa
aaatgggacgaacatctgtcaggtgccagaagctggcattattatatctgggatattctg
atgttcgaagcatggcgtgacgaacaaggtggatgtggataa

DBGET integrated database retrieval system