KEGG   Candidatus Puniceispirillum marinum: SAR116_2014Help
Entry
SAR116_2014       CDS       T01207                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SAR116_2014
Enzymes [BR:apb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     SAR116_2014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2219163..2220107
Genome map
AA seq 314 aa AA seqDB search
MKNQPLGGNDMPRFAGPGTMMRLPSADNAAGLNACFVGVPMDIGASNRPGTRFGPKQIRA
ESVMLRPYNMWTKAAPFDSIQVADIGDVPINTFDLKDSVKRITGFYDDVLTHDVIPLSLG
GDHTMTLPILRSMAKKHGPVGLIHVDAHADINEHMFGEEIAHGTPFRRAWEEKLINPERT
YQIGLRGTGYTAEDFDWARDKGFSVTQAEELWHRSAAPLMAKIKAALGDDPVYLSFDIDA
LDPAFAPGTGTQEIGGLTTIQALEIIRGCRGLNIVGCDLVEVSPPYDPQGSTALVAANLL
FEMLCVLPGVAYRS
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcagccattgggcggcaatgatatgccgcgttttgcagggcctggtacgatg
atgcgcctgccttcggctgataatgctgcggggttaaatgcctgttttgtcggcgtgcca
atggatatcggcgcatcaaatcgcccaggaacgcggtttggtcccaaacagattcgggcc
gagtcggtgatgcttcgcccctataatatgtggacaaaggcagcgccgtttgattcgatt
caggttgctgatattggtgatgtgccgatcaatacatttgatctgaaagactcggttaaa
cgcattaccgggttttatgatgatgtgctgacgcatgatgtgattccgctatcacttggt
ggtgatcatacaatgaccttgcccattttacgttcgatggccaaaaagcatgggcctgtt
ggtttgattcatgttgatgcccatgccgatataaatgagcatatgtttggtgaagagatt
gcgcatggcacgccgttccgccgcgcatgggaagaaaaactgatcaatccagaacgcacc
tatcagattggcttgcgcggcactggctatacagccgaagattttgactgggcgcgtgat
aagggtttttccgtaacccaagcggaagaattatggcatcgttccgccgcgccgttgatg
gcaaaaatcaaggctgcgctgggtgatgatccggtttatttaagttttgacattgatgcg
cttgatccggcttttgcgccaggcaccggcacgcaggagattggtggtctgacgacgata
caggcgcttgaaatcattcgtggttgtcgcggtttgaatattgtgggctgtgaccttgtt
gaagtctcgccgccatatgatccgcaaggcagtacggctttggtcgcggcgaatttgtta
tttgaaatgttatgcgttctgccgggcgtcgcatatcggagctag

DBGET integrated database retrieval system