KEGG   Candidatus Puniceispirillum marinum: SAR116_2021Help
Entry
SAR116_2021       CDS       T01207                                 

Definition
pyrazinamidase/nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SAR116_2021
Enzymes [BR:apb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     SAR116_2021
    3.5.1.-  
     SAR116_2021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2226407..2227012
Genome map
AA seq 201 aa AA seqDB search
MSALHALIVIDPQVDFCPGGALAVADGHSIMPHINAMMPAFDKVFITQDWHPEGHSSFAS
QHAGATPYSMIDMSYGPQTLWPDHCIAGSAGAAFHPDLNTDLAVAIIRKGMNPEVDSYSA
FFENDRTTTTGLGDLLRAHDVASVTLVGLATDFCVAWSALDAAKLGFNVAVELKACRAID
LDGSLDQAFDAMRSAGVTLKH
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccttgcacgctcttattgttattgatccacaggttgatttttgtccgggtggc
gcgttagcggttgccgacggtcacagtattatgccgcacataaatgcaatgatgcccgcc
tttgataaggttttcatcacgcaggattggcatcccgaaggccattcaagttttgcgtcg
caacatgcaggcgcgacgccctatagcatgatcgatatgtcctatgggccacaaacccta
tggccggatcattgtattgcgggaagcgctggggctgcctttcaccctgatcttaatact
gatctggcggtagcgattattcgtaagggcatgaatccggaagttgattcctattcagct
tttttcgagaatgaccgaaccacgacaactggacttggtgatctgttgcgtgcgcatgat
gtggcgtcggtgaccttggttggtctggcaactgatttctgtgttgcgtggtcagcactg
gatgcggcaaagcttggctttaacgtcgcggttgagctcaaggcctgccgtgcgattgat
cttgatggctcgcttgatcaggcttttgatgccatgcgttcagctggcgtgacgttgaag
cattag

DBGET integrated database retrieval system