KEGG   Candidatus Puniceispirillum marinum: SAR116_2035Help
Entry
SAR116_2035       CDS       T01207                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:apb00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2243503..2244474
Genome map
AA seq 323 aa AA seqDB search
MNDEKGDQAFRVTTETEMWPEMTYAGALSFLRRKYSRSLDGVDVVVSGIPYDNAVTYRSG
CRLGPRAIRAGGVQLSELKHFPYGFDPFETLSVIDYGDCYLDPHMPLTIFDAIEAHADHI
LASGAKMLSFGGDHSVAYPLLKAHAKIHGPITLVQFDAHCDTWPDDGVRFDHGTMFDRAV
NEGVVDASTSTQVGLRTYNDSDCGFEILTSPWIHRNGIDAAIEIVNERAGDNPVYLSFDI
DGLDPAFAPGTGTPVSGGLASWQGMEFIRGLEPLNLVGMDLVEVAPAYDHAEITAIAAAT
MAFNWLAVLAKKQGAATHPVGRL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatgaaaaaggtgatcaggcgtttcgcgttaccaccgaaaccgaaatgtggccg
gaaatgacctatgctggcgcgctcagttttttgcggcgaaaatatagccggtcattggac
ggtgtggatgttgttgtcagcggcatcccctatgataatgctgttacctatcgctcggga
tgccggcttggcccgcgcgcgatccgggcaggcggcgtacagctatccgagttgaaacat
tttccctatggctttgatccgttcgagacattgtcggtgatcgattatggtgattgttac
cttgatccgcatatgccgctgacgatttttgatgcgatcgaagcccacgctgatcatatt
ctggcatcaggtgccaaaatgctcagctttggtggcgatcattcggtggcctaccctttg
ttaaaggcgcatgccaaaatacacggcccgatcacgctggtgcaatttgatgcgcattgc
gatacatggccggatgatggtgtgcgctttgatcatggcaccatgtttgaccgggcggtg
aatgaaggcgttgttgacgccagcacatcaacacaggttggtttgcgtacctataatgac
agtgattgcggttttgagattctgaccagcccatggattcatcgaaatggcattgatgct
gcgattgagattgtcaacgaacgtgctggggataatccggtctatctgtcatttgacatt
gatgggcttgatccggcctttgcaccaggaacaggaacgccggtttcgggcgggctggcc
agctggcaggggatggaatttatccggggtctggaaccgctgaatctggtgggcatggat
ctggtcgaggttgcccccgcctatgatcatgccgaaatcaccgcgattgcggcggcaacg
atggcttttaactggcttgccgttctggccaaaaaacaaggtgcggcaacgcatccggtt
gggcgcctgtga

DBGET integrated database retrieval system