KEGG   Candidatus Puniceispirillum marinum: SAR116_2049Help
Entry
SAR116_2049       CDS       T01207                                 

Definition
PfkB protein (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SAR116_2049
Enzymes [BR:apb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SAR116_2049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2257882..2258802)
Genome map
AA seq 306 aa AA seqDB search
MSSIVILGIFVADTAYRAERIPRLGETILGKSFNLSPGGKGSNQAVAAAKAGANAHMITR
LGTDTFADMAIDVWQKAGVTPAITQHDNSYTGAACIFIEAETGNNAIIVTPGVAGEIDNS
DIDRNADLIANADIFITQLEQPLEVAMYGLELARKKGVRTLLNPAPAADLPDGMLALCDF
VTPNETEAEGLTGIKVTSVASATDAAQALRASGAGAAIITLGENGALYHDADTTIHMPAM
SSGKVIETTGAGDSFNGSFAAALAEGMTPVDAVKFGCAAAGISVTRAGAANSMPSRAEID
ARLAQG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccattgttattcttggtatttttgtggccgatacggcctatcgcgccgagcgt
attcctcggcttggtgaaacaattttgggtaaaagcttcaatcttagtcctggtggcaaa
gggtcaaatcaggctgttgccgcggcaaaggctggcgccaacgcacatatgatcacgcgg
ctaggcacggatacatttgccgatatggcaatcgatgtctggcaaaaggctggtgtgaca
cccgcaatcacccaacatgataacagctacacaggcgctgcctgcattttcatcgaggcc
gaaaccggaaataatgcgatcattgtcaccccgggcgttgctggcgagattgacaatagc
gacattgaccgcaatgcagacctgattgctaatgctgacatattcatcacccagcttgaa
cagccgcttgaggtagcaatgtatggtctggaactggcgcggaaaaaaggcgtgcgtaca
ttgctcaatccggcacctgccgctgaccttcctgatggtatgttggctttatgtgacttc
gtaacgcccaatgaaaccgaagccgaaggcctgaccggaattaaagtcacttcagttgca
agcgcaacagatgcggctcaggctttacgtgcgtctggtgcaggcgccgccattatcaca
cttggcgaaaatggcgcgctttatcatgacgctgacaccacaatacatatgcctgccatg
tcgtcaggcaaggtgattgaaaccactggtgctggtgattcctttaatggcagcttcgcc
gccgcccttgccgaaggcatgacgcctgttgatgctgtcaaattcggatgcgcagcggcg
ggcatttcagtcacccgcgccggtgccgcaaattccatgcccagccgggctgaaattgat
gcccgactagctcaaggttaa

DBGET integrated database retrieval system