KEGG   Candidatus Puniceispirillum marinum: SAR116_2240Help
Entry
SAR116_2240       CDS       T01207                                 

Definition
ACC deaminase/D-cysteine desulfhydrase (EC:3.5.99.7)
Orthology
K17950  
L-cysteate sulfo-lyase [EC:4.4.1.25]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:apb00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2458298..2459317)
Genome map
AA seq 339 aa AA seqDB search
MSHATSDLLAPFPRVSLCHQPTALEFMPRITTALGGPKLWVKRDDCTGLATGGNKTRKLE
FLIAAAIEAGADMVVTQGAVQSNHVRQTAAAACKFGLGCHALLERRVPDRADSYEQTGNV
LFDHLFGASIEYRPSGLDMNAEAIAVTEKLNASGRKAYFIPGGGSNEIGALGYVACAGEI
LQQSADQGLDLGWIVMATGSAGTQAGLVAGLHAAGSDVPVMGVSVRQAHDIQVKNVHGLA
VKTAATLTDTPLPVEKIIVDDGYVGAGYGLPTEGTLAAIELFARQEGLLFDPVYSGKGLD
GLINMVKQGFFDDAKDVVFLHTGGAAALFAYEAQLAAMG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcatgcgacttccgatttactagctcctttcccccgcgtcagcctatgtcaccag
ccaaccgcgctggaatttatgccgcgcataaccacagccctgggcgggccaaaactgtgg
gtcaagcgcgatgattgcacgggtctggcaacaggcggcaacaagacgcgcaagctcgaa
tttctgatcgccgccgctatcgaggctggcgccgatatggttgtcacgcaaggtgccgtc
cagtcaaatcacgtccgccagacggccgccgcggcctgtaaattcggcctcggttgtcat
gccctgcttgaacgtagggtgccggatcgtgcggattcatacgaacagacaggcaatgtg
ctgtttgatcatctatttggtgccagcatcgaatatcgtccaagcggccttgatatgaat
gccgaagccatcgccgtgaccgaaaagctgaacgcttcggggcgcaaggcctatttcatt
ccgggtggtggttcgaatgaaataggcgcgctgggctatgtcgcttgtgctggtgaaatt
cttcaacaatctgccgatcaggggcttgatctgggctggattgtcatggccactggcagt
gcggggacgcaggccggtctggttgccggcttgcatgcggcgggttctgatgtgccggtt
atgggcgtcagcgtacgccaggcacatgatattcaggtgaaaaatgtgcatgggctggcg
gtcaaaaccgccgcgaccctgaccgatacgcctttgccggttgaaaaaatcattgtcgat
gatggctatgtcggggctggctatggcttgccaaccgagggcacccttgccgcgatcgag
cttttcgcgcgtcaggaaggcctgctgtttgatccggtctattcgggcaagggtcttgac
ggtctgatcaatatggtcaaacagggcttttttgacgatgcaaaggatgtcgtgttcctg
catacaggcggcgcggcggcactattcgcctatgaagcacagctggcggcgatgggctga

DBGET integrated database retrieval system