KEGG   Candidatus Puniceispirillum marinum: SAR116_2293Help
Entry
SAR116_2293       CDS       T01207                                 

Definition
Holliday junction DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:apb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SAR116_2293
Enzymes [BR:apb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SAR116_2293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2508269..2508892
Genome map
AA seq 207 aa AA seqDB search
MIAQLRGILSHTADTHAIIDVQGVGYLVNISSRTQGQLAAQDGAVTVLTEMIVREDSMTL
YGFHDASERDAFRLLITVQGVGAKAAMAILSVLSPADLSSAIMAGDKAMVARADGVGPKI
AQRVVNELAEKIGRFPSLGDGLTINISGVTGGEDLPGASAMGDALSALINLGYGRSEAHA
ALLRVQQAGDADDLSGLIAAALREIGG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgattgcgcagcttcgcggtatcttatctcatacagccgatacgcatgccattatcgat
gttcaaggcgtcggatatctggtcaatatttcgagtcgtacccaaggtcagcttgcggca
caggatggtgcggttaccgttctgaccgaaatgatcgtgcgtgaagacagcatgacgctc
tatggctttcatgatgcgtccgagcgtgacgcctttcggttattgataacggtgcaaggg
gttggggcgaaagccgcgatggcgatcttatcggtattatctccagccgatctgagtagc
gccatcatggcaggtgacaaggcaatggtggcacgcgctgatggtgttggccccaaaatt
gcccagcgtgttgtgaatgagctagctgaaaaaattggccgcttcccgtcgcttggtgat
ggtcttacaatcaatatatctggcgttacaggcggcgaagatttgcctggtgcaagcgcg
atgggtgacgcattgtcggctctgataaatctgggatacggacgatctgaggcacatgca
gcgttgcttcgggtacagcaggctggcgacgcagatgatctgtctggattaatcgctgcc
gccttacgcgaaatcgggggctag

DBGET integrated database retrieval system