KEGG   Candidatus Puniceispirillum marinum: SAR116_2304Help
Entry
SAR116_2304       CDS       T01207                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAR116_2304
Enzymes [BR:apb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SAR116_2304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2519866..2520957
Genome map
AA seq 363 aa AA seqDB search
MSDYAPINYKAALTLPPFACPTWIRPLVQNTPLDGALPLAGGWRQFSHVDVVQRDDDNSY
AARRMHVDAVISTADDRNKAVAAIEHLTMPRADFAGLVMNKPQIMGILNVTPDSFSDGGQ
HNAPAKAIVAGAAMQTAGASIIDIGGESTRPGAEPITRNQELARILPPITGLAKAGALVS
VDTRHADVMTRATKAGAGIINDVGGLRGDGALVAASDSGVPVIIMHMQGTPESMQNDPHY
GFAPVEIYEFLEARISAAIDAGIPRDKIAVDPGFGFGKTVTHNMELMNWFGMLHGLGVPL
LLGASRKSTIAKISRDEAADDRLAGSIALALQGINEGAQMIRVHDVPETAQAIAVQMALY
DAV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgattacgctcctataaactataaggcggcacttacactgccgccttttgcatgt
ccgacgtggatacgtccacttgtgcaaaatacccctcttgatggcgccttaccgctggct
ggtggttggcggcaattcagccatgtggatgttgtgcaacgcgacgatgataacagctat
gcggcgcgccggatgcatgttgatgcggtcatatccacagcagatgaccgtaataaggcg
gttgcggctattgagcatctgacaatgccgcgtgctgattttgcggggttggtgatgaac
aagccgcaaattatgggcattttgaatgtaacaccagacagcttttccgatggtggtcag
cataacgccccagccaaggcaattgtggcaggtgctgcgatgcagacggcaggtgccagc
atcattgacattggtggtgagtcaacgcggcccggggctgagcctattacgcgaaatcag
gaactggcgcgtattttgccgcctatcacgggtcttgccaaggcaggtgcgttggtgtcg
gtggacacacgacatgctgatgtcatgacgcgggcaaccaaggcaggtgctggtattatt
aatgatgttggtgggttgcgcggcgatggcgcgctggtggcggcatccgacagcggtgtg
ccggtgattatcatgcatatgcaaggcacgcctgagtcaatgcagaatgatccgcattat
gggtttgcgcctgttgaaatttatgaatttcttgaggctcgtatcagcgccgctatcgat
gcgggcattccccgtgataaaattgctgttgatccgggctttggctttggcaagactgtg
acgcataatatggaattgatgaactggtttggtatgcttcatggccttggcgtgccgcta
ttgcttggtgctagccgtaaatccaccattgccaaaatatccagagatgaagcggctgac
gatcggcttgctggcagcatcgcattggcattgcaaggcatcaatgaaggcgcgcagatg
atccgcgtgcatgatgtgcctgaaaccgcccaggccatcgccgtgcagatggcgttatat
gatgccgtttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system