KEGG   Candidatus Puniceispirillum marinum: SAR116_2363Help
Entry
SAR116_2363       CDS       T01207                                 

Definition
phospholipid hydroperoxide glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SAR116_2363
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SAR116_2363
Enzymes [BR:apb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SAR116_2363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2580835..2581431
Genome map
AA seq 198 aa AA seqDB search
MFEPASHIAFVAPSKSVSIWAIILLFVTFVTEPLMPAHAKNAHDISFENIEGGTLDLAEF
RGKVILLVNTASQCGFTPQYEALQAMWDNYRDRGLVVIGVPSNDFGGQEPGANSQIKQFC
TINYGIDFPMTEKVAVTGSDIHPYYQWVLEAGGRLAMPRWNFYKHLIDQEGNFVTWFAAT
TAPDARKIRQAIEKLLPN
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaacctgcgtcacatatagcctttgtagcaccatccaaatcggtatctatctgg
gctattattctgctgtttgtaacatttgtaacggagcctctgatgcctgcacatgccaag
aacgcccatgatatttcgttcgaaaatatcgaagggggcacgcttgaccttgccgaattt
cgcggcaaggtgattttgcttgtcaacacagcgtcacaatgtggtttcacaccgcaatat
gaagctttgcaagctatgtgggataattatcgtgaccgcggtctggtggtgattggcgtg
ccaagcaatgattttggtggtcaggaaccaggcgccaattcccagatcaagcaattctgc
acgatcaattatggcattgattttccaatgactgaaaaggttgcggtcaccggatcggat
atacatccctattatcaatgggtgcttgaagctggtggacgtttggcgatgccacgctgg
aacttttacaaacatctgatcgatcaagagggtaattttgtcacctggtttgccgcgacc
accgcgccggatgcccggaaaatccggcaggctattgaaaagcttctacccaattag

DBGET integrated database retrieval system