KEGG   Candidatus Puniceispirillum marinum: SAR116_2473Help
Entry
SAR116_2473       CDS       T01207                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAR116_2473
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAR116_2473
Enzymes [BR:apb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SAR116_2473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2676512..2677816)
Genome map
AA seq 434 aa AA seqDB search
MSARTEFETHTKTDAGRFDGIKRDYSLADVKKLSGSVQPEHTLARNGANKLWNLLHSEDY
VHSLGALSGNQAMQMVRAGLKAIYLSGWQVAADSNTAGAMYPDQSLYPANSGPELARKIN
RTLQRADQIQTLENNDDNIDWFAPIIADAEAGFGGALNAFELTRSYIEAGAAGVHFEDQL
ASEKKCGHMGGKVLIPVQQHIANLNAARLAADTAGVPTLIVARTDAESAKLITSDIDERD
HQFLTGERTEEGFFCLDPKDAFERCVVRGLAFAEYADLIWMETSTPNIEQARRFADAIHA
KFPNKMLAYNCSPSFNWSANLSPEDIARFQREIGAMGYKYQFITLAGFHSMNFAMYELAR
DYRDRGMAAYSELQNAEFDAEVNGYTATRHQREVGAGWFDAISVAVKGGQSATTALNDST
EEAQFSGDQEKAAE
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcgcaccgaatttgaaacgcataccaaaactgacgctggccgctttgacggc
atcaagcgtgattacagtctggcggatgtgaaaaaactgtcgggttcggtgcaacctgaa
catacgctggcacgcaatggcgcgaacaagctatggaatttgctacatagtgaagattat
gtgcattcactgggcgcgctatccggcaaccaagcgatgcagatggtgcgtgctgggttg
aaagcgatttatctgtccggatggcaggtcgcggctgactcgaatacggctggtgccatg
tatcctgaccagtcgctctatcccgccaattcaggccctgagctagcgcgcaagatcaac
cgcacattacagcgggctgaccaaattcagacgctggaaaataacgatgacaatattgac
tggtttgccccgatcattgccgatgccgaagccggcttcggtggcgcgctcaatgcgttt
gaactgacccgaagctatatcgaagctggtgcggccggcgtgcattttgaggatcaactc
gcatctgaaaagaaatgcggtcacatgggcggcaaggttctaatccccgtacaacagcac
atcgccaatctgaatgcggcacgtctggccgctgatacggcaggggtgccaaccttgatt
gtcgcccggactgacgccgaaagcgccaagctgatcacctcggatattgatgaacgcgat
catcagttcctgacaggcgaacgcaccgaagaaggctttttctgtcttgatccgaaagat
gcttttgagcgttgtgtggtgcgcggccttgcctttgccgaatatgccgatctgatttgg
atggaaacatcaacacctaacatcgagcaggcacgccgctttgctgatgccatccatgcc
aaattcccgaacaagatgctggcctataattgttcgccaagctttaactggtcggcaaac
ctttcgcctgaagacattgcccgcttccagcgtgaaattggcgcgatgggttataaatat
cagttcatcacattggctggtttccattccatgaattttgccatgtatgaacttgcacgc
gattatcgtgaccggggcatggccgcctatagtgaattacagaatgccgaattcgacgcc
gaggtgaatggctataccgccacccgccatcagcgcgaagttggtgctggctggtttgac
gcgatttcagtggctgttaaaggtggccagtctgcaaccactgcgcttaatgactcgacc
gaagaggcccaattttcaggcgaccaggaaaaggctgccgaatag

DBGET integrated database retrieval system