KEGG   Alpha proteobacterium HIMB59: HIMB59_00000640Help
Entry
HIMB59_00000640   CDS       T02249                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HIMB59_00000640
Enzymes [BR:apc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     HIMB59_00000640
Exosome [BR:apc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HIMB59_00000640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
61229..62149
Genome map
AA seq 306 aa AA seqDB search
MKNYFPIRKTNKLSKQILIQPMFVDQRLKSPKKIKGLGENYSWSQNTILRNVEKDLKKGI
RNFLLFIVPKEKQKLPEDFSFHYEVIRSLKNHFKKDLTLLIDTCLCSITPDGHCGISHNK
KINLPQTHYALGLAANTYLEAGADIIAPSDMMKDTTQYLRKVFSENEFNSAQIMSYSTKF
KSGFYGPFRDAANSTPKGYDRSSYQLPVSDRTKAIQSSIINAAQGANYLMVKPGMTSIDL
IQDIKAETLLPTGAYQVSGEFASLQLLDSQGLGKYPDLLMESLQVFSRAKADYIITYGAR
DIVSYL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattattttccaattagaaaaacaaataaactctctaaacaaatattaattcaa
ccaatgtttgtggatcaaaggctcaaatctcccaaaaaaattaagggcttaggagaaaac
tatagctggtctcaaaacaccattcttcgaaatgtagaaaaagatttaaaaaaaggaatt
cgaaattttcttttatttatagtcccgaaagaaaaacaaaaattacctgaagattttagt
tttcattatgaagttattcgttccctaaaaaatcattttaaaaaagatctgactttgtta
attgatacttgcctatgttctattactcctgatggacattgtggcatctctcacaataaa
aaaattaatttaccacaaacacattatgctttaggtctggctgctaatacatatctggaa
gcaggtgctgatatcatagctccaagcgatatgatgaaagataccacacaatatttaaga
aaagtatttagtgagaatgaatttaattctgctcagattatgagctattcaacgaagttt
aaaagtggcttttacggccctttccgagatgcagctaactctactcccaaaggatatgat
cgttcttcttatcaactccctgttagtgatcgtacaaaggctattcaaagctcaattatc
aatgcggctcaaggagctaattatttaatggtcaaaccaggaatgacctctattgattta
attcaagatattaaagccgagacccttcttcccacaggggcttatcaagtcagtggagag
tttgctagtttgcaattattagactctcaagggttgggaaaatatcctgatttgttaatg
gagtcactgcaagtatttagtcgagcaaaagcagattatattatcacatacggagcaaga
gatattgtctcctatttataa

DBGET integrated database retrieval system