KEGG   Alpha proteobacterium HIMB59: HIMB59_00001440Help
Entry
HIMB59_00001440   CDS       T02249                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:apc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    HIMB59_00001440
  Metabolism of other amino acids
   00480 Glutathione metabolism
    HIMB59_00001440
Enzymes [BR:apc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     HIMB59_00001440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
130578..131063
Genome map
AA seq 161 aa AA seqDB search
MTGTSMAQNIYNFSINDIDGNVINFNEFQGKPILLVNTASRCGFTKQYANLSNLHREYLD
KNLIIISTPSNSFKQELSEEEDVKEFCLVNYQTKFILTEIIEVKGDNAHPLYQWIANDYG
KTPKWNFYKYLFDGQGNLVESWSSMTKPDSKKITDQIDRLI
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacaggaacaagtatggcacaaaacatctataatttttctattaacgatattgatggc
aatgtaatcaattttaatgaatttcaaggaaaacctattttattagtgaacaccgcaagt
cgttgtggtttcaccaaacagtatgccaatctctctaatcttcatcgagagtacttagat
aaaaatctcattatcataagcacaccctccaactcctttaagcaagaattaagtgaggag
gaagacgtcaaagaattttgcctagtaaattatcaaacaaaatttattttaacggagatc
attgaagttaaaggagataatgctcatccgctgtatcaatggatagcaaatgattatggg
aaaacacccaagtggaatttttataaatacttatttgatggtcagggcaatcttgtcgaa
agctggtcgtcgatgacaaagcctgatagcaaaaaaatcacagatcaaattgatcgatta
atttaa

DBGET integrated database retrieval system