KEGG   Alpha proteobacterium HIMB59: HIMB59_00002210Help
Entry
HIMB59_00002210   CDS       T02249                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:apc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HIMB59_00002210
  Amino acid metabolism
   00300 Lysine biosynthesis
    HIMB59_00002210
Enzymes [BR:apc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HIMB59_00002210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
197360..198523
Genome map
AA seq 387 aa AA seqDB search
MLDTIELSKKLIEFDSVTPAKQDIFDFLIKIFKEQGFDTKQLNFDGDGSYEVINLMATYG
SPQTNGKHFNFLCHVDVVPPGNIEDWDTHPFEPTIKDGYLYGRGSEDMKGCTAASMVSVF
KFIKDNPDFNGTISFIITGDEEADSINGVDKVVNWLQENNIRIDGSIATESSSEKVIGDQ
IKVGRKGAVDVQIEVIGKQGHAAYPQLAQNPVHCLSKIISFFDDQVLDQGAEYFEPSSLQ
FTQVNLNNKAKNVIPERLITVGDMRFNDNWDKEKIEAYFNEHLTRICGENNCQYKLKLTF
RGLPFQAFNDPFTIHCLNAIKDVTGLEAKQDTGGGTSDARFMQRICPVFEFGTINKTLHK
VNECVSISDLQTTEQIYYKTLENFFQS
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatacaattgaattatccaaaaaactcattgagttcgattcagttacaccagca
aagcaagatatctttgactttcttattaaaatttttaaagaacaaggttttgatacaaag
cagttaaactttgatggcgatggaagctatgaagtaattaatttaatggcaacctatgga
tcacctcagactaatggaaagcatttcaattttttatgtcatgtggatgtagttccacct
ggtaatatagaagattgggatacccacccttttgaaccgacaattaaagatggttactta
tatggtcgtggctcggaagacatgaaaggttgtactgctgcaagtatggtaagtgtattt
aaattcattaaagataatcctgattttaatggaaccattagttttattattactggagat
gaggaggctgactcaatcaatggtgtagataaagttgttaattggcttcaagaaaataat
atccgcattgacggatccatagcaacagaatcctcttctgaaaaagtgatcggtgatcaa
attaaagtgggaaggaaaggagctgttgatgttcaaattgaggtaattggcaaacaaggt
catgccgcctaccctcaattagctcaaaaccctgtccattgcttatccaaaataatttct
ttttttgatgaccaagtactcgaccaaggagcagaatattttgaaccttcaagccttcaa
tttacacaagtaaacttaaataataaggccaagaatgttatcccagagaggttaatcaca
gtaggcgatatgcgatttaatgataattgggataaagaaaaaattgaggcctattttaac
gaacatcttactcgtatctgtggtgaaaataattgccagtataaacttaaattaactttt
agaggtctaccatttcaagcattcaatgatccgtttactatacattgtttaaatgccatc
aaagatgtgactggattagaagcaaagcaagatacaggtggaggtacttctgatgcccga
tttatgcagagaatttgtcctgtttttgagttcggtacaatcaataaaactttacacaaa
gtcaatgaatgtgtatcgatcagtgaccttcaaacaactgagcaaatttattacaaaacc
ttagaaaacttttttcaatcatga

DBGET integrated database retrieval system