KEGG   Alpha proteobacterium HIMB59: HIMB59_00002280Help
Entry
HIMB59_00002280   CDS       T02249                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:apc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HIMB59_00002280
DNA repair and recombination proteins [BR:apc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HIMB59_00002280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(202683..203279)
Genome map
AA seq 198 aa AA seqDB search
MAQDELQKLINLISRLPGIGQRSAQRIALYLIKNKQELMLPLGDSVKETAAKVRKCEICG
MLDVNLPTKICSSDTRIKNTICIVEDMADVWAFERSGFYKGQYHVIGGLLSASKNFTEQD
LRLHKLKERIEKNKVEEVILALSATIEGQTTALVIRDYLEKMNLKITQLAYGVPVGSEIH
YLDDNTLGAALESRKNLS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttggctcaagacgaattacaaaaacttatcaacttaatttcccgtttgcctggaatcggt
caacgttctgctcagagaatagccttatatctgataaaaaataagcaagagttaatgctt
cccttgggagatagcgttaaagagacagcagcaaaagttaggaaatgtgaaatttgtggg
atgttagatgtaaatttaccgaccaagatatgctcatcggatacaagaataaaaaataca
atttgtatagtcgaagatatggcagatgtatgggcatttgaacgatcaggtttttataag
gggcaatatcatgtcattggaggtcttttatcagcatcaaaaaattttacggagcaagat
cttcgcttacataaactcaaagagagaatagaaaaaaataaagtagaagaggttatttta
gctttaagcgctactattgaaggccaaactacagccttagttatccgagattatttagaa
aagatgaatttaaaaattactcagttagcatatggggttcctgtgggaagcgaaatccat
tatcttgatgataatactttgggcgccgctctggagtctcgtaaaaatttaagctag

DBGET integrated database retrieval system