KEGG   Alpha proteobacterium HIMB59: HIMB59_00002330Help
Entry
HIMB59_00002330   CDS       T02249                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:apc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    HIMB59_00002330
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HIMB59_00002330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
206954..207472
Genome map
AA seq 172 aa AA seqDB search
METNKILGAIILALLLAAVFSKVADMAIHPEYPEELAYQIDIPEVGASGAQAEEVDIFAV
LPEITPLLASADMGNGEKLFKKCASCHTNNKGGENKVGPAMWGIVDRAKAASEGFAYSGA
LANFGGDWSVEELNKFLLKPKKYIEGTKMNFNGLKKDQDRADLIKYLSSLAD
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggaaactaataaaattctaggtgcaattatactagctttactgcttgctgctgtcttt
tctaaagtagcggatatggctatccacccagaatatccagaagaactagcttaccaaatt
gatatcccagaagttggcgcttcaggagcacaagctgaagaggtagatatttttgctgtc
ctaccagaaataactccattgcttgcatcagcagatatgggaaatggagaaaaacttttt
aagaagtgtgcttcatgtcataccaacaataaaggcggcgaaaataaagttggtccagca
atgtggggtattgtcgatagagcaaaagctgcttcagagggttttgcttattcgggtgca
ttagcaaatttcggtggtgattggagcgtagaggaattgaacaaattcttgcttaaacca
aaaaaatacattgaaggcaccaaaatgaatttcaatggtcttaaaaaagaccaagataga
gctgatttaattaaatatttaagctctcttgctgattaa

DBGET integrated database retrieval system