KEGG   Alpha proteobacterium HIMB59: HIMB59_00002600Help
Entry
HIMB59_00002600   CDS       T02249                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:apc00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
233078..234559
Genome map
AA seq 493 aa AA seqDB search
MKDYILSIDQGTTSTRVIIFDKNFNFKSSSQKEFKQIFPRDGEVEHDPEEIYQSVLFTAK
EAIRKAKIKSSQIRSIGITNQRETTVLWDKTNGKPVYNAIVWQDRRTVKFCKSLVKKGFA
KKIQKITGLIVDSYFSASKIHWLLNNSKKSKELLKKDKLLFGTIDTWLLWKLTDGQSHYT
EATNASRTMLFDIKKNQWSKEMLQIFKVPEKILPIVKDSADDFGQTTKFGSKIPIQGIAG
DQQAATIGQACLEPGSIKSTYGTGCFMIMNVGSKLKYSKNKLLSTIAYRIRGKNTYALEG
SIFIAGAAVQWLRDSLKIIKNAKDTEDLYSKNDPTQKVYLVPAFVGLGAPYWDGEARGAL
FGLTRNTGIPEFVKATIDSVVYQTKDLILAMEKDSGIRIKKIKVDGGMVNNNQFVQFLSN
LLLCECLRPKINETTSLGVAYLAGYQSGLIKKFTDINSKWKSEKRFVHKMNKKDVEQLYL
GWKKAIKGTLTIK
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattatattctctctattgatcaagggacaacttctacccgagtaattattttt
gataaaaattttaactttaaatcatcgagtcaaaaagaatttaaacaaatttttcctaga
gatggagaagttgagcacgacccagaagaaatttatcaatcagttttgtttacagccaaa
gaggctattcgaaaggctaaaataaaatcttcacaaataagatctattggaattactaat
caaagagagacgacagtcctgtgggataaaaccaatggcaaacctgtttacaatgcaatt
gtgtggcaagatagaagaactgttaaattttgtaaaagtcttgtaaaaaaaggttttgca
aaaaaaatacagaaaattactggtttaattgttgactcatatttttcagcttcgaaaata
cattggcttttgaataattcgaaaaagtcaaaagaattactaaaaaaagataagttatta
ttcggcactatcgatacttggttattgtggaaactgactgatggccaaagccactacacc
gaggcgactaatgcatcgagaacaatgctttttgatattaaaaaaaatcaatggtcaaaa
gaaatgcttcaaatatttaaagtgcctgaaaaaattcttccaattgtcaaagatagcgct
gatgattttggtcaaacaacaaaatttggcagtaaaatcccaattcaaggaatagccgga
gaccaacaagcagcaacgattggacaagcctgtttagaacctggttcaataaaatcaact
tatggaactggttgttttatgatcatgaatgtaggttcaaaattaaaatattctaaaaat
aaattactctccacgattgcctatcgtataagaggaaaaaatacttatgccttggagggg
tcaatttttattgctggagcagctgttcaatggctaagagactcgcttaagataatcaaa
aatgcaaaagatactgaagatctttattcaaaaaatgatcctactcagaaagtttatttg
gtacctgcatttgtaggattaggtgcaccatattgggatggcgaagcaagaggtgctctt
tttggacttactcgtaatacaggcattcctgaatttgtaaaagctacgatagacagtgtc
gtttaccaaacaaaagatttaattttagccatggaaaaagatagtggtattagaataaaa
aaaattaaagtcgatgggggtatggttaacaataaccagtttgtccaatttttatcaaat
ttacttttgtgtgaatgtttaagacccaagattaatgagactacatcgttgggagtagca
tatttagctggatatcaaagtggtttaataaaaaaatttactgacataaatagtaagtgg
aaaagtgaaaaaaggtttgttcataaaatgaacaaaaaagatgttgaacaactatattta
ggttggaagaaagcaatcaaaggcactctaaccataaaataa

DBGET integrated database retrieval system