KEGG   Alpha proteobacterium HIMB59: HIMB59_00002630Help
Entry
HIMB59_00002630   CDS       T02249                                 

Definition
2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HIMB59_00002630
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HIMB59_00002630
  Amino acid metabolism
   00310 Lysine degradation
    HIMB59_00002630
Enzymes [BR:apc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HIMB59_00002630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(238170..239249)
Genome map
AA seq 359 aa AA seqDB search
MTDITVPELGESIIEGTLTAWLVKEGASFQAGDNLAEIETEKITIEIPAQSAGTISKILV
SEGSSVKVGEVIAQFSQGGEATTSSPSKVEQEETPAPPSKPVEEPKVEKSHENQTKNSEP
AISNFDEQVDKEGERSVPMSKLRQTIARRLKDAQNTAAILTTFNEVDMTAIMALRKKQQA
AFQKKHGVKLGIMSFFVKACVQVLKELPEINSEIFEDKIIYKNYFDIGVAIGSEKGLVVP
IIRNAENLSNAEIEKEIINLATKANSNKLAMKDLSGGTFSITNGGVYGSMMSTPIINPPQ
SAILGMHSIIERPIAVKNKVVIRPMMYTALSYDHRLIDGKQAVTFLVRLKEILEDPKVD
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatattaccgtaccagaattaggcgagtccataatcgagggaactttgactgcg
tggttagtcaaagagggagcttcttttcaagcaggggataacttagcagaaattgaaact
gaaaagataacaattgaaattcccgctcaatcagcaggtacaatttccaaaattttagtt
tctgaaggaagttcagtaaaagtaggtgaggtaattgcgcaattttctcaaggtggagag
gccactacttcatctccatcaaaagtggaacaagaagagactcctgccccaccttcaaaa
ccagttgaagagccaaaagtcgaaaaaagtcatgaaaatcagacaaaaaactcagaacca
gctatctctaattttgatgagcaggtggataaagagggtgaaagatcagttccaatgtca
aagctgcgccaaacaattgctcgaagattaaaagatgcacaaaatacagcggctatttta
acaaccttcaacgaagttgatatgacagctattatggctttgcgaaaaaaacaacaagct
gctttccaaaaaaaacatggagttaaactaggcatcatgtctttttttgtaaaagcatgt
gttcaggttttaaaggaactacctgaaataaactcagaaatttttgaagataaaataatt
tataaaaattattttgatattggcgttgcaattggttctgaaaaaggactagtggtccct
attattcgcaatgcagaaaatttatctaatgctgaaattgaaaaagaaataattaattta
gctactaaagcaaactctaataagttagctatgaaagatttatcaggggggaccttttcc
attactaatggaggtgtttatggatccatgatgagcaccccaattattaatcctcctcaa
agtgcaatccttggaatgcattctattattgagcgacccattgctgtcaaaaataaagtt
gtgatacgacctatgatgtatactgcgcttagttatgatcatcgactaattgatggtaag
caagccgtcactttcttagtgagactaaaagaaattttagaagatccgaaggtcgattaa

DBGET integrated database retrieval system