KEGG   Alpha proteobacterium HIMB59: HIMB59_00002630Help
Entry
HIMB59_00002630   CDS       T02249                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
apc00020  Citrate cycle (TCA cycle)
apc00310  Lysine degradation
apc01100  Metabolic pathways
apc01110  Biosynthesis of secondary metabolites
apc01120  Microbial metabolism in diverse environments
apc01130  Biosynthesis of antibiotics
apc01200  Carbon metabolism
Module
apc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HIMB59_00002630
  Amino acid metabolism
   00310 Lysine degradation
    HIMB59_00002630
Enzymes [BR:apc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HIMB59_00002630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 DUF1387 RnfC_N Peptidase_M23 Inhibitor_I71
Motif
Other DBs
NCBI-ProteinID: AFS48466
UniProt: J9YZW8
Position
complement(238170..239249)
Genome map
AA seq 359 aa AA seqDB search
MTDITVPELGESIIEGTLTAWLVKEGASFQAGDNLAEIETEKITIEIPAQSAGTISKILV
SEGSSVKVGEVIAQFSQGGEATTSSPSKVEQEETPAPPSKPVEEPKVEKSHENQTKNSEP
AISNFDEQVDKEGERSVPMSKLRQTIARRLKDAQNTAAILTTFNEVDMTAIMALRKKQQA
AFQKKHGVKLGIMSFFVKACVQVLKELPEINSEIFEDKIIYKNYFDIGVAIGSEKGLVVP
IIRNAENLSNAEIEKEIINLATKANSNKLAMKDLSGGTFSITNGGVYGSMMSTPIINPPQ
SAILGMHSIIERPIAVKNKVVIRPMMYTALSYDHRLIDGKQAVTFLVRLKEILEDPKVD
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatattaccgtaccagaattaggcgagtccataatcgagggaactttgactgcg
tggttagtcaaagagggagcttcttttcaagcaggggataacttagcagaaattgaaact
gaaaagataacaattgaaattcccgctcaatcagcaggtacaatttccaaaattttagtt
tctgaaggaagttcagtaaaagtaggtgaggtaattgcgcaattttctcaaggtggagag
gccactacttcatctccatcaaaagtggaacaagaagagactcctgccccaccttcaaaa
ccagttgaagagccaaaagtcgaaaaaagtcatgaaaatcagacaaaaaactcagaacca
gctatctctaattttgatgagcaggtggataaagagggtgaaagatcagttccaatgtca
aagctgcgccaaacaattgctcgaagattaaaagatgcacaaaatacagcggctatttta
acaaccttcaacgaagttgatatgacagctattatggctttgcgaaaaaaacaacaagct
gctttccaaaaaaaacatggagttaaactaggcatcatgtctttttttgtaaaagcatgt
gttcaggttttaaaggaactacctgaaataaactcagaaatttttgaagataaaataatt
tataaaaattattttgatattggcgttgcaattggttctgaaaaaggactagtggtccct
attattcgcaatgcagaaaatttatctaatgctgaaattgaaaaagaaataattaattta
gctactaaagcaaactctaataagttagctatgaaagatttatcaggggggaccttttcc
attactaatggaggtgtttatggatccatgatgagcaccccaattattaatcctcctcaa
agtgcaatccttggaatgcattctattattgagcgacccattgctgtcaaaaataaagtt
gtgatacgacctatgatgtatactgcgcttagttatgatcatcgactaattgatggtaag
caagccgtcactttcttagtgagactaaaagaaattttagaagatccgaaggtcgattaa

DBGET integrated database retrieval system