KEGG   Alpha proteobacterium HIMB59: HIMB59_00003410Help
Entry
HIMB59_00003410   CDS       T02249                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:apc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:apc00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:apc00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:apc00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:apc00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
306194..308110
Genome map
AA seq 638 aa AA seqDB search
MKDFPLNNPLLTQEQYDQMYADSFTNKEQFWSKIAKEQVTWFKDFTKIKNTNYEGDVSIK
WFEDGELNVCYNCVDRHAEQRPDDTAIIWEGDDPSQSKTYTYKELQSEVSRFANVLKKLG
VKKGDRVTIYLTMIPEVAFAMLACTRIGAIHSVIFGGFAPESIAGRIQDCQSQFVITADE
GLRGGKTIPLKKYINTALESCDDSIKTLVVRYTNTQDDLHQKNDFYYDELLKEVDDQCAC
EPMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYASFTHKYSFDYHPGDVYWCTADAGWI
TGHSYSLYGPLANGAQTLLFEGVPNYPDFSRFWQVCDKHKVNIFYTAPTAIRALMKEGND
FVTQCDLSSLRILGTVGEPINPEAWNWYSSIVGKDKCPVVDTWWQTETGGHLISPIPGVT
KLKPGSATHPYFGIEAVIVDDNGNVLEGECEGKLCMLDSWPGQMRTVYGNHQRFVETYFS
QFKGKYFTGDGCRRDKDGFYWITGRVDDCINVSGHLLGTAEIESAFVEHALVSEAAVVGY
PHDIKGQGIYAYVTTNTGVEVSDELKKELTLWIRQKIGPIATPDKIQFAPGLPKTRSGKI
MRRILRKIASHEEDQLGDTSTLADPGVVQSLIDGSKDI
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaaagactttcctttaaacaaccccctactcactcaagaacaatacgatcaaatgtat
gctgactcttttacaaataaagagcagttttggtcaaaaattgccaaagaacaagtcact
tggtttaaagattttactaagatcaaaaatactaactacgaaggagatgtttccattaag
tggtttgaagatggagaattaaacgtctgttataactgcgtggatcgacatgctgagcaa
agacccgatgatacggccatcatttgggagggagatgatccaagccaatccaaaacctat
acctataaagaattacaaagcgaggttagtcgatttgccaatgtgcttaaaaaacttggc
gtcaaaaaaggtgatcgcgttactatttatctgacgatgatcccagaggtggcgttcgcg
atgctggcgtgtactcgtattggtgctattcactctgtgatctttggtggttttgcaccg
gagtcaattgcaggacgtattcaagattgccaatctcaatttgttattactgctgatgag
ggacttcgaggtggaaaaactatccctttaaaaaaatatattaatacagccctagagagc
tgtgatgactcgattaaaacattagttgttcgttatacgaatactcaagatgatcttcat
caaaaaaatgatttttattatgatgagcttctaaaagaagttgatgatcaatgtgcgtgc
gagcccatgaatgctgaagaccctttgtttattttatatacctcaggttcaactggaaaa
cccaaaggtgttttacatacaacaggaggttatttagtttatgcctcttttacacataaa
tactcttttgattaccatcctggagatgtttattggtgcactgcggatgcgggttggatt
accggtcactcttattctttatatggtccgcttgctaacggagctcaaacgctactcttt
gaaggcgtgcctaactatcctgatttttcaagattttggcaagtatgtgataagcacaaa
gtcaatattttctatacagcgccaacagcaatacgcgctttaatgaaagaaggaaatgat
tttgtcactcaatgtgatttatcctctcttcgtattttaggaactgtgggtgaacccatc
aatccagaggcttggaactggtactctagtattgttggaaaagataaatgtcctgtcgtc
gatacttggtggcaaacagaaacaggaggacatttaatctctcctataccaggtgtcact
aaactcaagcccggaagcgcaacacatccctactttggaattgaagcagtgatcgtcgac
gataatggaaacgttttagagggagagtgtgagggcaaactgtgcatgctagatagttgg
cctggtcaaatgagaacggtttatggaaatcatcaacgttttgtagaaacgtattttagt
cagtttaaaggaaagtatttcaccggagatggttgtcgtcgtgataaagatggtttttat
tggataacaggtcgtgttgatgattgtattaatgtgtcaggtcatttgttgggcactgct
gaaatagaaagtgcctttgtggagcatgcactcgtatcagaagcggcagttgtcggatat
cctcacgatattaagggtcaaggaatttatgcctacgtcactactaacacgggagtagaa
gtaagtgatgaattaaaaaaagagctaacattatggatacgtcaaaaaattgggcctatt
gctacccctgataaaattcaatttgcacccgggctgcccaaaacaagatcagggaaaatc
atgagaagaattcttcgtaaaatcgcatcccatgaggaagatcaattgggagacacttca
acgctcgccgatcccggagtggtacaatctttaatagacgggtctaaagatatctag

DBGET integrated database retrieval system