KEGG   Alpha proteobacterium HIMB59: HIMB59_00003410Help
Entry
HIMB59_00003410   CDS       T02249                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
apc00010  Glycolysis / Gluconeogenesis
apc00620  Pyruvate metabolism
apc00640  Propanoate metabolism
apc00680  Methane metabolism
apc01100  Metabolic pathways
apc01110  Biosynthesis of secondary metabolites
apc01120  Microbial metabolism in diverse environments
apc01130  Biosynthesis of antibiotics
apc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HIMB59_00003410
   00620 Pyruvate metabolism
    HIMB59_00003410
   00640 Propanoate metabolism
    HIMB59_00003410
  Energy metabolism
   00680 Methane metabolism
    HIMB59_00003410
Enzymes [BR:apc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HIMB59_00003410
Lipid biosynthesis proteins [BR:apc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HIMB59_00003410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AFS48542
UniProt: J9YZL0
Position
306194..308110
Genome map
AA seq 638 aa AA seqDB search
MKDFPLNNPLLTQEQYDQMYADSFTNKEQFWSKIAKEQVTWFKDFTKIKNTNYEGDVSIK
WFEDGELNVCYNCVDRHAEQRPDDTAIIWEGDDPSQSKTYTYKELQSEVSRFANVLKKLG
VKKGDRVTIYLTMIPEVAFAMLACTRIGAIHSVIFGGFAPESIAGRIQDCQSQFVITADE
GLRGGKTIPLKKYINTALESCDDSIKTLVVRYTNTQDDLHQKNDFYYDELLKEVDDQCAC
EPMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYASFTHKYSFDYHPGDVYWCTADAGWI
TGHSYSLYGPLANGAQTLLFEGVPNYPDFSRFWQVCDKHKVNIFYTAPTAIRALMKEGND
FVTQCDLSSLRILGTVGEPINPEAWNWYSSIVGKDKCPVVDTWWQTETGGHLISPIPGVT
KLKPGSATHPYFGIEAVIVDDNGNVLEGECEGKLCMLDSWPGQMRTVYGNHQRFVETYFS
QFKGKYFTGDGCRRDKDGFYWITGRVDDCINVSGHLLGTAEIESAFVEHALVSEAAVVGY
PHDIKGQGIYAYVTTNTGVEVSDELKKELTLWIRQKIGPIATPDKIQFAPGLPKTRSGKI
MRRILRKIASHEEDQLGDTSTLADPGVVQSLIDGSKDI
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaaagactttcctttaaacaaccccctactcactcaagaacaatacgatcaaatgtat
gctgactcttttacaaataaagagcagttttggtcaaaaattgccaaagaacaagtcact
tggtttaaagattttactaagatcaaaaatactaactacgaaggagatgtttccattaag
tggtttgaagatggagaattaaacgtctgttataactgcgtggatcgacatgctgagcaa
agacccgatgatacggccatcatttgggagggagatgatccaagccaatccaaaacctat
acctataaagaattacaaagcgaggttagtcgatttgccaatgtgcttaaaaaacttggc
gtcaaaaaaggtgatcgcgttactatttatctgacgatgatcccagaggtggcgttcgcg
atgctggcgtgtactcgtattggtgctattcactctgtgatctttggtggttttgcaccg
gagtcaattgcaggacgtattcaagattgccaatctcaatttgttattactgctgatgag
ggacttcgaggtggaaaaactatccctttaaaaaaatatattaatacagccctagagagc
tgtgatgactcgattaaaacattagttgttcgttatacgaatactcaagatgatcttcat
caaaaaaatgatttttattatgatgagcttctaaaagaagttgatgatcaatgtgcgtgc
gagcccatgaatgctgaagaccctttgtttattttatatacctcaggttcaactggaaaa
cccaaaggtgttttacatacaacaggaggttatttagtttatgcctcttttacacataaa
tactcttttgattaccatcctggagatgtttattggtgcactgcggatgcgggttggatt
accggtcactcttattctttatatggtccgcttgctaacggagctcaaacgctactcttt
gaaggcgtgcctaactatcctgatttttcaagattttggcaagtatgtgataagcacaaa
gtcaatattttctatacagcgccaacagcaatacgcgctttaatgaaagaaggaaatgat
tttgtcactcaatgtgatttatcctctcttcgtattttaggaactgtgggtgaacccatc
aatccagaggcttggaactggtactctagtattgttggaaaagataaatgtcctgtcgtc
gatacttggtggcaaacagaaacaggaggacatttaatctctcctataccaggtgtcact
aaactcaagcccggaagcgcaacacatccctactttggaattgaagcagtgatcgtcgac
gataatggaaacgttttagagggagagtgtgagggcaaactgtgcatgctagatagttgg
cctggtcaaatgagaacggtttatggaaatcatcaacgttttgtagaaacgtattttagt
cagtttaaaggaaagtatttcaccggagatggttgtcgtcgtgataaagatggtttttat
tggataacaggtcgtgttgatgattgtattaatgtgtcaggtcatttgttgggcactgct
gaaatagaaagtgcctttgtggagcatgcactcgtatcagaagcggcagttgtcggatat
cctcacgatattaagggtcaaggaatttatgcctacgtcactactaacacgggagtagaa
gtaagtgatgaattaaaaaaagagctaacattatggatacgtcaaaaaattgggcctatt
gctacccctgataaaattcaatttgcacccgggctgcccaaaacaagatcagggaaaatc
atgagaagaattcttcgtaaaatcgcatcccatgaggaagatcaattgggagacacttca
acgctcgccgatcccggagtggtacaatctttaatagacgggtctaaagatatctag

DBGET integrated database retrieval system