KEGG   Alpha proteobacterium HIMB59: HIMB59_00005350Help
Entry
HIMB59_00005350   CDS       T02249                                 

Definition
alcohol dehydrogenase family protein with GroES-like domain,Zinc-binding dehydrogenase
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:apc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    HIMB59_00005350
Enzymes [BR:apc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     HIMB59_00005350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
489222..490277
Genome map
AA seq 351 aa AA seqDB search
MKAQVLHSYDPDMKQDVWVKEEEVPNPKLEKSTDVIVKIGAAGVCRTDLHIIEGVWRHIQ
DPEDKLLPCVMGHENAGWVEEVGSDVEGFKKGDPVILHPLISGGTCLNCRRGHDMHAADG
AFPGLNIKEGGYSELLRTGVRNLIKLPTILTPKDVAPFSDAGLTAYRVVKKATRHLLPGQ
SCVVIGAGGLGHIAIQCLRAMCAANIIIVEKSQTALDHAMPLGGDHGVLIDGNEIERVKE
LTKGNGAEAVIDFVGEHGSTKMGLDMTANAGSYYIVGYGEKIEILAVDAIISEKSIIGNL
VGTWAELYELMELADKGLVKLSMQEYKLSEANKALHDLNTGQVKGRAVLVP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcacaagtattacatagttacgatcctgatatgaaacaggacgtctgggtgaaa
gaagaagaggttcctaacccaaaattagaaaaatccactgacgttattgtgaaaattggt
gcagctggtgtttgccgaacagatttacatattattgaaggtgtatggagacatatccaa
gatccagaagataaacttttaccttgcgtaatgggccatgaaaatgctggttgggtcgaa
gaggtcggaagcgacgtggaaggctttaaaaaaggcgatccagttattttacacccacta
atttctggtggcacttgtttgaactgtcgtcgtggtcatgatatgcacgcagccgatggt
gcatttccaggtttaaatattaaagaaggtggttactctgaacttttacgtacaggtgtc
agaaacctcattaagctaccaacgattttaacaccaaaagatgttgcacctttttctgat
gcgggtttaactgcatatcgtgttgtgaaaaaagcaacacgtcacttattaccgggtcag
tcctgtgtagtaatcggtgcaggtggacttggtcatattgctattcagtgtttacgagca
atgtgtgcagcaaatattatcattgttgagaaatctcaaacagcacttgatcatgcaatg
cctttgggcggcgatcatggcgtcttgattgatggtaatgaaattgagcgagtcaaagaa
ttaactaaaggcaatggtgcagaggcagtgattgactttgtgggtgagcacggctcaacc
aaaatgggtctggatatgactgctaatgcgggttcttattatattgtaggttacggtgag
aaaattgaaattcttgcggtggatgcaattatctctgagaagagcatcattggtaattta
gtaggtacatgggcagaactctatgaattgatggagttagccgataaaggcctcgtaaaa
ctttccatgcaggaatacaagttaagcgaagccaataaagcacttcatgatttgaacact
ggtcaagtcaaaggaagagctgttttagtaccataa

  All links  
No link information was found.   
DBGET integrated database retrieval system