KEGG   Alpha proteobacterium HIMB59: HIMB59_00005460Help
Entry
HIMB59_00005460   CDS       T02249                                 

Definition
alpha-amylase-like glycosyl hydrolase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:apc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(501963..503687)
Genome map
AA seq 574 aa AA seqDB search
MNTFHKKVFSHLKIIYQHILSDEEINNLTDQIFEITPQVKNDDRLENWNESDIFLITYGD
SIVSAKDKKLKTLKKFVDEFIKPHFNNIHILPFFPFSSDDGFSVIDYKKVRDDLGSWEDI
SLLSKDYRVMADIVINHASKQSEYFQEFIRGSYEYKDFFISLDENEGFEEVVRPRSSDLF
QEIEISNQKKYLWCTFSHDQIDLNFKNPRVLLFFIKLIYLYLKHGIKVFRLDAVAFLWKE
KSTNCLNLPQTHEVVKLIRTILDHYNQNTLLITETNLPNLENLSYFGNGDEANAIYNFTL
PPLLLWTLLMGDSTALRKWSMGMPPAKEHTTYFNFIASHDGIGLRPTENILTDQERGTLI
DIVKEFGGVISNRKKPDGTETVYELNIALLDAMKGTFKGIDHMQVERFIACHAIMLSLEG
IPAFYIHSVLGTTNDYELMKKNSQNRSINRKSWDINEIKNKLLDDKSINNQVYKSIINLI
KIRKTQPAFHPNAIQFTFNLGKNFFGIWRQSLDKKQSIFSVTNVTNIFQYLDLTELNLIE
SEKWWDIINNKDIDDIKSTIALKAYQTVWITNHK
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
ttgaatacatttcataaaaaagttttttcacatctaaagattatttatcagcatatttta
tcagatgaagaaataaataatttaacagatcaaatttttgaaataactccacaagtaaaa
aatgatgataggttagaaaattggaatgaaagtgatatttttttaattacttatggagac
tctatagtttctgcaaaggataaaaaattaaaaactttaaaaaaatttgtcgatgaattt
ataaagcctcatttcaataatattcatatcttgccattttttccatttagttcagatgat
ggtttttctgtaattgattataaaaaagttcgtgatgatttaggaagttgggaggatatt
agtttattatctaaagattatcgggtaatggctgatattgtgatcaaccatgcctctaaa
caaagtgaatattttcaggaatttattagagggagttatgaatacaaagattttttcatc
tcgcttgatgaaaatgaaggatttgaagaagttgttcgtcctaggagttctgatctattt
caagaaatagaaattagtaatcaaaaaaaatatttatggtgcacctttagccatgatcaa
attgatttaaattttaaaaatcccagagtattattgttttttatcaagttaatttacctt
tatttaaagcacggtattaaagttttcaggcttgatgcagttgcgtttttatggaaagag
aaaagtactaattgtcttaatcttccccaaacgcacgaggttgtaaaactaattcggacg
attttagatcattataatcagaatactttattaattaccgagactaacctgcctaatctt
gaaaatcttagttattttggaaatggcgatgaggcgaatgcaatttataattttacgctt
ccccctcttcttctttggactctgttaatgggagatagtacagctctaagaaaatggtca
atgggtatgcctccagctaaagaacacacaacttattttaattttattgcttcacatgat
ggaattggtcttcgtcctactgaaaatattttgaccgatcaagaaagaggtacattaatt
gatatagtcaaagaatttggtggggttataagtaatcgaaaaaaacctgatgggactgag
actgtgtatgagctaaatatagctctccttgatgccatgaagggcacattcaaaggcatc
gatcatatgcaggttgaaagatttattgcctgccatgctattatgttaagtttggaggga
attcccgctttttatattcatagtgttctgggaacaactaatgattatgagctaatgaaa
aagaattcccaaaatagatcaattaataggaagtcttgggatattaatgaaattaaaaat
aaattacttgatgataaatcaataaataatcaagtttacaaatcaattataaatttaatt
aaaatcagaaaaacacagccagcttttcatcctaatgcaattcaatttacatttaactta
ggaaaaaatttttttggtatttggaggcaaagtctcgataaaaaacaatccatttttagt
gttactaatgtgacaaatatttttcaatatctagatttaaccgaattaaatttaattgaa
tcagaaaaatggtgggacattataaataataaagatatagacgatataaaatcaactata
gcactaaaggcttatcaaacagtatggattacaaatcataaataa

DBGET integrated database retrieval system