KEGG   Alpha proteobacterium HIMB59: HIMB59_00005490Help
Entry
HIMB59_00005490   CDS       T02249                                 

Definition
glycosyl hydrolase family 4,Family 4 glycosyl hydrolase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:apc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    HIMB59_00005490
  Lipid metabolism
   00561 Glycerolipid metabolism
    HIMB59_00005490
   00600 Sphingolipid metabolism
    HIMB59_00005490
Enzymes [BR:apc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     HIMB59_00005490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(506176..507492)
Genome map
AA seq 438 aa AA seqDB search
MSNRIVIIGAGSTNFGLGIVGDFFKSKILEGSTLVLHDINAKTLENTKNIALSYKEKLGV
NFEIQATTSRSEALRDAHFCLISIEVGRRFDLWDQDWKTPLQYGIKQVYGENGGPGGMFH
AMRQVPAIIEICEDIEKICPEAFVFSYSNPMQRICHALTTRFPNLKIIGLCHEVKSMDRQ
LPTLLETPLENIEFEAGGLNHFSILLKVNYKDTGKDGYPIIREKFNDYYSTLVNDHEGFI
SKPGAERGVFFELFNQYNYLPITTDSHIGEYLPWAYSVADHDGILDFYENYKRKCLNYYE
NDSYDEYFNPEVKEPHERIVPIIENIVNDTNALEHAVNIPNKGFIECLPSDIVVEVPAII
NKSGIHGKKLENYPQSFGVLLNSQVGAIQMTTQAILNHSKKDALFALLADPVVHDAKAAS
SLLDTMLFQQNDYLGYLN
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcgaatagtaattataggtgcaggcagtactaattttggattaggtattgtt
ggagatttttttaaatctaaaattttggagggttctacccttgtgctgcatgatattaat
gccaaaacccttgaaaatactaagaatatagctctttcttataaagaaaaattaggagtt
aattttgaaattcaagctactacttcaagatcagaggccttaagagatgcccatttttgc
ttaatttctatcgaagtgggtcgtcgatttgatttgtgggatcaggattggaaaacccct
cttcagtatggcatcaaacaagtttatggagaaaacggaggacccggaggtatgtttcat
gcaatgcgtcaagtgccagctattattgaaatttgcgaagatattgaaaagatttgtcca
gaggcatttgtttttagttactctaatccaatgcaaaggatatgtcatgctttgaccacg
cgttttcctaatttaaagatcataggcctttgtcatgaagtaaaatcaatggaccgacaa
ctaccaactcttcttgagacccctttggaaaatattgaatttgaagcaggtggtctaaac
catttttcgatactccttaaagtaaattacaaggatactggcaaagatggttatcctatt
ataagagaaaaatttaatgattattattccactcttgttaatgaccatgaaggttttatt
tcaaagccaggagcagagcgaggagttttttttgaattatttaatcaatataattatctt
ccaatcacaacagatagtcacataggcgaatatcttccatgggcctatagcgtcgctgat
catgatggtatcctagatttttatgaaaactacaaaagaaaatgcttaaattattatgag
aatgacagttatgatgaatattttaatcctgaagtaaaagagcctcatgaaagaatagtt
cctataattgaaaatatagttaacgatactaatgcattggagcatgcggttaatattcct
aataaaggttttattgaatgccttccatcagatattgtcgtggaagtaccagcaataata
aataaaagtggaatacatggtaagaaattagaaaattatcctcaatcatttggggtttta
ttaaattcacaagttggtgccattcaaatgacgactcaagcaattctcaatcattctaaa
aaagatgccttgtttgcactattggcagatcctgtggtacacgatgcaaaagccgcatca
tcactattagataccatgctttttcaacaaaatgattatttaggatatttgaattaa

DBGET integrated database retrieval system