KEGG   Alpha proteobacterium HIMB59: HIMB59_00006390Help
Entry
HIMB59_00006390   CDS       T02249                                 

Definition
(GenBank) Phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
apc00010  Glycolysis / Gluconeogenesis
apc00030  Pentose phosphate pathway
apc00051  Fructose and mannose metabolism
apc00052  Galactose metabolism
apc00680  Methane metabolism
apc01100  Metabolic pathways
apc01110  Biosynthesis of secondary metabolites
apc01120  Microbial metabolism in diverse environments
apc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:apc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HIMB59_00006390
   00030 Pentose phosphate pathway
    HIMB59_00006390
   00051 Fructose and mannose metabolism
    HIMB59_00006390
   00052 Galactose metabolism
    HIMB59_00006390
  Energy metabolism
   00680 Methane metabolism
    HIMB59_00006390
Enzymes [BR:apc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HIMB59_00006390
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     HIMB59_00006390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AFS48838
UniProt: J9YZ18
Position
complement(592236..593318)
Genome map
AA seq 360 aa AA seqDB search
MKKIGILTSGGDCGGLNAAVRSIFYRAKNTYGMEVLGIRDGTVGLMQRPVAYLPLDYQTF
SGALLRQGGTFLGTTNKGNPFKFPMADGSFKDRSQEIIDGYHELGLEGLIVIGGDGSMAI
LTEIAKRGDLKIVAIPKTIDNDVGATESSIGFNTAVNVATQALDNLQSTAASHHRTMILE
VMGRDAGHIAINAGIAGGADVILIPELNYSIKGVVNKLTEMKNRGIVHSLIVVAEAVKTE
DGKTYEVEFADGQKRLGGIGTYLSEAIMKNTDIECRVTSLGHVQRGAPPTPRDRILASAF
GVYAVDLLAQGKFDRMVAWRDRKVIDVPISEGISTYKVVDRTDPLIETALALGVYVGDID
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattggaatacttacaagtggtggtgattgcggtggattaaacgcagctgta
cgctccattttttacagagctaaaaatacttatgggatggaggttctgggaattcgagat
ggtacggtgggtttaatgcaaagaccagttgcttaccttcctttagattatcaaactttt
agtggagctcttttaagacagggtggaacttttcttggaacaacgaataaaggcaatcca
tttaaattccccatggctgacggttcatttaaagatcgctcccaagaaattattgacggt
tatcacgaactaggacttgaaggtttgattgttattggtggtgatggaagtatggcgatc
ttaactgaaattgccaagcgaggtgatttgaagatagtcgccattcctaaaacgattgac
aatgatgtcggagccacagaaagctctattggttttaacaccgcagtaaatgtagctacc
caggccctggataatctgcagtcaactgcagccagtcatcatagaacaatgattttagag
gttatgggcagagatgctggacatatcgcgattaatgcaggcattgcaggtggagctgat
gtcatattaattccagagctaaactattcaattaagggcgtagttaataagctaacagaa
atgaaaaatagaggaattgttcattctttaatagtagttgcagaagccgtcaaaactgaa
gatggcaaaacatacgaagtagaatttgctgatggtcaaaaaagactcggtggaataggc
acctatttatctgaagcaataatgaaaaatacagatattgaatgtcgagtaacttcttta
ggtcatgttcaaagaggtgccccacctacaccaagagatagaatattagcaagtgctttt
ggagtgtatgcagttgatttactcgcacagggtaaatttgatcgtatggtagcatggaga
gaccgtaaggtgattgatgttcccatttcagaaggtatttctacttataaagttgttgat
cgaacagaccccctaattgaaacagcattagcactgggtgtttatgtcggtgatattgac
tga

DBGET integrated database retrieval system