KEGG   Alpha proteobacterium HIMB59: HIMB59_00006390Help
Entry
HIMB59_00006390   CDS       T02249                                 

Definition
Phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:apc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HIMB59_00006390
   01230 Biosynthesis of amino acids
    HIMB59_00006390
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HIMB59_00006390
   00030 Pentose phosphate pathway
    HIMB59_00006390
   00051 Fructose and mannose metabolism
    HIMB59_00006390
   00052 Galactose metabolism
    HIMB59_00006390
  Energy metabolism
   00680 Methane metabolism
    HIMB59_00006390
Enzymes [BR:apc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HIMB59_00006390
Protein phosphatases and associated proteins [BR:apc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HIMB59_00006390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(592236..593318)
Genome map
AA seq 360 aa AA seqDB search
MKKIGILTSGGDCGGLNAAVRSIFYRAKNTYGMEVLGIRDGTVGLMQRPVAYLPLDYQTF
SGALLRQGGTFLGTTNKGNPFKFPMADGSFKDRSQEIIDGYHELGLEGLIVIGGDGSMAI
LTEIAKRGDLKIVAIPKTIDNDVGATESSIGFNTAVNVATQALDNLQSTAASHHRTMILE
VMGRDAGHIAINAGIAGGADVILIPELNYSIKGVVNKLTEMKNRGIVHSLIVVAEAVKTE
DGKTYEVEFADGQKRLGGIGTYLSEAIMKNTDIECRVTSLGHVQRGAPPTPRDRILASAF
GVYAVDLLAQGKFDRMVAWRDRKVIDVPISEGISTYKVVDRTDPLIETALALGVYVGDID
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattggaatacttacaagtggtggtgattgcggtggattaaacgcagctgta
cgctccattttttacagagctaaaaatacttatgggatggaggttctgggaattcgagat
ggtacggtgggtttaatgcaaagaccagttgcttaccttcctttagattatcaaactttt
agtggagctcttttaagacagggtggaacttttcttggaacaacgaataaaggcaatcca
tttaaattccccatggctgacggttcatttaaagatcgctcccaagaaattattgacggt
tatcacgaactaggacttgaaggtttgattgttattggtggtgatggaagtatggcgatc
ttaactgaaattgccaagcgaggtgatttgaagatagtcgccattcctaaaacgattgac
aatgatgtcggagccacagaaagctctattggttttaacaccgcagtaaatgtagctacc
caggccctggataatctgcagtcaactgcagccagtcatcatagaacaatgattttagag
gttatgggcagagatgctggacatatcgcgattaatgcaggcattgcaggtggagctgat
gtcatattaattccagagctaaactattcaattaagggcgtagttaataagctaacagaa
atgaaaaatagaggaattgttcattctttaatagtagttgcagaagccgtcaaaactgaa
gatggcaaaacatacgaagtagaatttgctgatggtcaaaaaagactcggtggaataggc
acctatttatctgaagcaataatgaaaaatacagatattgaatgtcgagtaacttcttta
ggtcatgttcaaagaggtgccccacctacaccaagagatagaatattagcaagtgctttt
ggagtgtatgcagttgatttactcgcacagggtaaatttgatcgtatggtagcatggaga
gaccgtaaggtgattgatgttcccatttcagaaggtatttctacttataaagttgttgat
cgaacagaccccctaattgaaacagcattagcactgggtgtttatgtcggtgatattgac
tga

DBGET integrated database retrieval system