KEGG   Alpha proteobacterium HIMB59: HIMB59_00006810Help
Entry
HIMB59_00006810   CDS       T02249                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HIMB59_00006810
   00052 Galactose metabolism
    HIMB59_00006810
Enzymes [BR:apc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     HIMB59_00006810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
635537..636496
Genome map
AA seq 319 aa AA seqDB search
MIKSHTLENQFLKIKTINIGASLYEVIDKRKKINLILNLGNFKNYLKNKPYLGATCGRFA
NRIKNGQFKIDSKTYHLSKNEGKNILHGGHQGFDSKTWKIKRQNSNSITYEYLSPHLEEG
FPGNLKVQCKYQIHKNSFKIIFSAQSDQKSHVNLVNHAYWNLNKSKTSIFDHFLLINANS
YLKNDPTNIPTGEYKNVNQTPYDFRQFRHIGQQIELNRKAFDENFVLNKRQKFAACLWSP
HSGILLSIKTNQPGIQFYSGQHLRYKSLKKTLSPFQGLCLETQAFPNSPNNKKFPSTLVS
PNKKYLHEVSFLINHQKIV
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
ttgattaaatctcatactttagaaaaccaatttcttaaaataaaaacaatcaatattgga
gctagtctctatgaagttattgataaaagaaaaaagataaatttaattttaaatttaggt
aattttaaaaactatttaaaaaataaaccttatcttggggctacttgtgggagatttgcc
aatcgaattaaaaatggacaattcaaaattgactcaaaaacctatcatctctctaagaat
gaaggtaaaaatattttacatggtggacatcaaggtttcgactcaaagacatggaaaatt
aaaagacaaaactcaaatagtattacatatgaatatttgtctcctcatttagaagaaggt
ttcccaggaaatcttaaagtgcaatgtaaataccaaattcataaaaattcttttaaaatt
atcttttcagcacaatctgatcagaaatctcatgttaatttagtcaaccatgcgtattgg
aatctgaataaatcgaaaacttctatctttgatcatttcctcttaataaatgccaattca
tatttgaaaaatgaccccaccaatatccctacaggtgagtataaaaatgtaaatcaaacc
ccatatgatttcagacaatttcgacatattggtcaacaaatcgagttaaatcgtaaggct
tttgacgaaaattttgttttaaataagaggcaaaaatttgctgcttgtttatggtctcct
catagtggcattttattgtctattaaaacaaatcaacctggtatccaattttatagcggt
caacatctgagatataagtcattaaaaaaaacactcagtccttttcagggattatgtctt
gaaacacaagcttttccaaatagccctaataacaaaaagtttccttcaacattagtatct
ccaaataagaaatatttgcatgaggtgagttttttaataaatcaccaaaaaatagtttag

DBGET integrated database retrieval system