KEGG   Alpha proteobacterium HIMB59: HIMB59_00006860Help
Entry
HIMB59_00006860   CDS       T02249                                 

Definition
D-xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:apc00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:apc00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
640876..642183
Genome map
AA seq 435 aa AA seqDB search
MSDYFQSIPKIKFEGKDSQNPLAFKFYNPQQKVLGKTIEDHLRMAVCYWHTFNWPGNDPF
GGQTFLRPWMDHQDAIDQATDKLENAFSFFDKLDIPYFCFHDVDIAPEGNNFAETEIIQK
KIVDLISKKLETSKVKLLWGTANLFSHRRYMAGAATNPNPEIFQYAAAQVKMCIENTHHL
GGQNYVLWGGREGYETILNTNMKQEFDQLGRFLNMVAEHKHKIGFQGNLLIEPKPHEPTK
HQYDFDSANVFAFLQKYGLEKEFKLNIEVNHAILAKHSFEHEIAYALANDIFGSIDINRG
DYLVGWDTDQFPNNTEELLLPFYYLFKNQGLGSGGLNMDAKIRRQSIDPEDLFYAHIGAM
DTCARTLLAVERMINDGSYEEFLNKRYENWSQNKELMQSSSLESIYEKVKSKDINPEPQS
GRQEYLENLLNSFIE
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattattttcaatcaattccaaaaataaagtttgagggcaaagatagccaaaat
cctttagcttttaagttttacaatccgcaacaaaaggtattgggaaaaactatcgaggat
catttgagaatggcagtatgttattggcatacgtttaattggcctggtaatgaccctttt
ggaggtcaaacatttcttagaccttggatggatcatcaagatgccattgatcaagctaca
gataaattggaaaatgccttctctttttttgataaactagatattccttatttttgtttc
catgatgttgatattgcacctgaggggaataattttgctgagactgaaataattcaaaaa
aaaatagttgatttaatttctaaaaaacttgaaacctcaaaagtaaaattactatggggg
actgctaatttatttagtcaccgaagatatatggctggcgcagccacaaaccctaaccca
gaaatttttcaatatgctgcagcacaggtaaaaatgtgtattgagaatactcatcactta
ggaggtcaaaattatgtgctttggggaggtcgtgagggttatgaaaccattttgaatacc
aacatgaaacaagagttcgatcaattgggtcgctttcttaacatggtagctgaacacaaa
cataaaattggatttcaaggtaaccttttaattgaacctaagcctcatgagcctactaaa
catcaatatgattttgactcggctaacgtttttgcttttcttcaaaaatacgggttggaa
aaagaatttaaacttaatatagaagtgaatcatgccattttagccaaacactcatttgaa
catgagatcgcatatgctttagctaatgatatttttggtagcattgatattaatcggggc
gattatctagttggatgggataccgatcagttccctaataataccgaagaacttttatta
cctttttattatcttttcaaaaaccaaggacttggtagtggtggcttaaatatggatgct
aaaatcagacgtcaatctatagatcctgaagatttgttttatgcgcatattggagctatg
gacacttgtgctagaacactattagcagttgagagaatgattaacgatggttcttatgaa
gaatttttgaataaaagatatgaaaattggtctcaaaataaagaattaatgcaatcttcc
tcattggaaagtatctacgaaaaggttaaatcaaaagatattaatcctgaaccacaatcc
ggtagacaggaatatcttgaaaacttgttaaactcttttattgaataa

DBGET integrated database retrieval system