KEGG   Alpha proteobacterium HIMB59: HIMB59_00007600Help
Entry
HIMB59_00007600   CDS       T02249                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:apc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HIMB59_00007600
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HIMB59_00007600
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HIMB59_00007600
Enzymes [BR:apc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HIMB59_00007600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
702006..703358
Genome map
AA seq 450 aa AA seqDB search
MNYVSTRNNQINFSSEQVLNYGLAPDGGLFIPSELPKFSSEDLNNLKNADYKEIAYFVLN
PFLKDLFSEKEIKHLISDAYQSFDEGIVSITELGENQLLNLFHGPTLAFKDYAMCLLAKI
YELYLRKKNQKLVIVGATSGDTGSAAIHAFKGIENIDIFILHPHNATSLFQRKQMTTSGA
DNVFNIALEGSFDDCQTLVKKTFNDQELSTKYHFTAINSINWFRILPQSIYYAWAYLNHN
VDSFVVPSGNFGNIYSAHLLKSMGFPLKNLVIATNENNILHRIIANNDFSLTDVIKTNSP
SMDITISSNFERILAESFNPEELSHLYQNLINHAHNPKLDETVHEQLAGKFKSEYATSEE
VQKCIKKYFDSNNVLIDPHTAVGVVCAEKMNLSNHMCLACAHPVKFQETVTKSLGHEIEY
DKNFEFKSSEKFEILKNDYNLLKEFILNNA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaattatgtcagcactcgtaataatcaaataaatttcagttctgaacaagttttgaac
tatggcttggctccagatggaggattatttattccaagtgaacttccaaagttttcttca
gaggatttaaataacttaaaaaacgctgactacaaagaaatagcatattttgttctaaac
ccttttttaaaagatttattttcagagaaagaaataaaacacctgatttcagatgcttat
caaagttttgatgaaggaatcgtctctataactgagttaggtgaaaatcaattattaaat
ttatttcatgggccaacattagcttttaaagattacgcaatgtgtcttttagctaaaata
tatgagctatatcttagaaaaaaaaatcaaaaactagtaattgtgggagcaacttcaggt
gatacaggttctgcagcaattcatgctttcaagggtattgaaaatatagatatttttatt
cttcaccctcataacgccacatctcttttccaaagaaaacagatgacaactagtggagct
gacaatgtatttaatattgctcttgagggaagttttgatgattgccagactttggtaaaa
aaaacttttaatgatcaagaactaagtaccaaatatcatttcacagcgatcaactctatc
aattggtttagaatattgcctcaatctatttattatgcttgggcttatctaaatcacaat
gttgatagcttcgtagtaccaagtggaaatttcggaaatatctattcagcacacctttta
aagtcaatgggctttccccttaaaaatcttgttatagcgactaatgaaaataatatttta
catagaattatagctaacaatgatttttcattaactgatgtaattaaaacaaatagccca
agtatggacataaccatttcaagtaattttgaacgaattttagcagagtcatttaaccca
gaagaattatctcatttatatcaaaatttgataaatcacgcacacaaccccaaactagat
gagactgtccacgagcagttggctggtaaatttaagtcagagtatgcaacatcagaagaa
gtccaaaaatgtatcaagaaatactttgatagtaataatgttttgattgacccacatacc
gctgttggggtagtttgtgcggaaaaaatgaatttaagtaatcatatgtgcttggcttgt
gcccatccggtaaaatttcaagaaaccgtaacaaaatctctcggtcatgaaattgaatat
gataaaaactttgaatttaagagtagtgaaaaatttgaaatactaaaaaatgattataat
cttttgaaggagtttattttaaacaatgcctaa

DBGET integrated database retrieval system