KEGG   Alpha proteobacterium HIMB59: HIMB59_00007800Help
Entry
HIMB59_00007800   CDS       T02249                                 

Definition
GHMP kinase family protein
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HIMB59_00007800
Enzymes [BR:apc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HIMB59_00007800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
719473..720312
Genome map
AA seq 279 aa AA seqDB search
MKSKKEMKIHKLISPAKINLNLKVIKFDKKLKKHKLSSQIAIIKLHDVIEIKPSNDLSVI
YRDTNKKKIFVKNDIIKKTIKYFDKKYKKKSKFNILVDKKIPIGYGIGGGSSNAASILKY
LYKFYKINPQNFFDDAPELGSDVLLFFNQTPKIIDGIKSYRILNKNTARWKKIYLIFPRT
KNLTASIFSHFQKNSISEKTTKNPFRNDLLKSSLAVNSEFFDIYSLMISEKKNFSFFGMS
GSGSSIFFNFDKISSERSVIQLIKQKFPLVRIEKSYYFG
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaaagaaagaaatgaaaattcataaattaatttcccctgcaaaaattaattta
aatttaaaagttattaaatttgataaaaagttaaaaaaacataagctttcatctcagata
gctattatcaaattacatgatgtaatagaaataaaaccatcaaatgatttatctgtaatt
tatagagatactaataaaaaaaaaatatttgtaaaaaatgatataataaaaaaaacaatc
aaatactttgataaaaaatacaaaaaaaaatcaaaatttaatattcttgtagataaaaaa
ataccaataggatacggcataggtggtggatcatcaaatgctgcttctattttaaaatat
ctttataaattctataaaataaatccccaaaacttttttgatgatgctcctgaactagga
tcggatgtattgttattttttaatcaaactccaaaaattattgatggaataaaaagctat
aggatacttaataaaaatacagctagatggaaaaaaatttatttaatttttccaagaaca
aaaaatttaacagcttcaatattctcacattttcaaaaaaattctataagcgaaaaaaca
acaaaaaatccttttagaaatgatctattgaaatcttctcttgcggtaaactccgagttt
tttgatatttattcactgatgatatctgaaaaaaaaaatttttccttttttggtatgagt
ggcagcggttctagtattttcttcaattttgataaaatcagctcagaaagatcagtaatt
caattaattaagcaaaaatttccattggttagaattgaaaaatcttattatttcggataa

DBGET integrated database retrieval system