KEGG   Alpha proteobacterium HIMB59: HIMB59_00007800Help
Entry
HIMB59_00007800   CDS       T02249                                 

Definition
GHMP kinase family protein
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:apc00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
719473..720312
Genome map
AA seq 279 aa AA seqDB search
MKSKKEMKIHKLISPAKINLNLKVIKFDKKLKKHKLSSQIAIIKLHDVIEIKPSNDLSVI
YRDTNKKKIFVKNDIIKKTIKYFDKKYKKKSKFNILVDKKIPIGYGIGGGSSNAASILKY
LYKFYKINPQNFFDDAPELGSDVLLFFNQTPKIIDGIKSYRILNKNTARWKKIYLIFPRT
KNLTASIFSHFQKNSISEKTTKNPFRNDLLKSSLAVNSEFFDIYSLMISEKKNFSFFGMS
GSGSSIFFNFDKISSERSVIQLIKQKFPLVRIEKSYYFG
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaaagaaagaaatgaaaattcataaattaatttcccctgcaaaaattaattta
aatttaaaagttattaaatttgataaaaagttaaaaaaacataagctttcatctcagata
gctattatcaaattacatgatgtaatagaaataaaaccatcaaatgatttatctgtaatt
tatagagatactaataaaaaaaaaatatttgtaaaaaatgatataataaaaaaaacaatc
aaatactttgataaaaaatacaaaaaaaaatcaaaatttaatattcttgtagataaaaaa
ataccaataggatacggcataggtggtggatcatcaaatgctgcttctattttaaaatat
ctttataaattctataaaataaatccccaaaacttttttgatgatgctcctgaactagga
tcggatgtattgttattttttaatcaaactccaaaaattattgatggaataaaaagctat
aggatacttaataaaaatacagctagatggaaaaaaatttatttaatttttccaagaaca
aaaaatttaacagcttcaatattctcacattttcaaaaaaattctataagcgaaaaaaca
acaaaaaatccttttagaaatgatctattgaaatcttctcttgcggtaaactccgagttt
tttgatatttattcactgatgatatctgaaaaaaaaaatttttccttttttggtatgagt
ggcagcggttctagtattttcttcaattttgataaaatcagctcagaaagatcagtaatt
caattaattaagcaaaaatttccattggttagaattgaaaaatcttattatttcggataa

DBGET integrated database retrieval system