KEGG   Alpha proteobacterium HIMB59: HIMB59_00008520Help
Entry
HIMB59_00008520   CDS       T02249                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:apc01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:apc00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
785959..787230
Genome map
AA seq 423 aa AA seqDB search
MKIVNKNWILSNLKSSLQTSSSVSSTVKSIIEDIKKNGDKALLKYVKKFENSKATIKNIK
LSKQDLKRAYNSISRQDKEALKLAYKRIHYYHTKQKKPSYSYKDQLDTKFYVQWNPIDNV
GLYIPGGMASYPSTVLMTSIPAKIAKVPNVMLCVPSKNGITSNLTLAAAYICGVDQVYNI
GGAQAIAAFAHGTKTIKKADKVFGPGNQFVAEAKKQLFGTIGIDLPAGPSEVLVIANNKS
NPNWIAYDVLAQAEHDPNAKTYVVSTSKNLLEKVKKEISSLVQNSKIQNIDQSIKNHCFL
ILSQGKKEIYEISNFIAPEHLHIHSKFSKDLLKNIIHAGSVFVGEKAPVALGDYTIGTNH
VLPTDQTAKFASGLSVDDFMKKTVFIDVGDKTLKKISKPTSHLARKEGLEAHALSVEIRK
IKT
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatagtcaataaaaattggattttatccaacttaaaatcatcccttcagacttca
tcttcagtttcttcaaccgtgaagtctattatcgaagacataaaaaaaaatggtgataaa
gcacttttaaaatatgttaaaaagtttgaaaattctaaagctacaattaaaaatataaaa
ttatcaaagcaagatttaaagagagcgtataattctatatcaagacaagataaagaagct
ttaaaattagcttataaaagaattcattactatcacaccaaacaaaagaaaccttcttat
tcttataaagatcaattagatactaagttttacgttcaatggaatcccatcgataatgtc
ggtctttatatccccgggggcatggcttcttatccctcaacagttttgatgacttcaatc
cctgctaaaatagcaaaagtacccaatgtgatgctttgcgttccatctaaaaatggaatt
acttccaatttaacattagctgcagcttatatttgtggtgttgatcaagtttataatatt
ggtggggcccaagctatagctgcttttgctcatggaacaaaaactataaaaaaagctgat
aaagtttttggtcctggtaaccagtttgtagcggaagcaaaaaaacaactttttggtacc
attggtatcgatctacctgcgggcccatcggaggtgcttgttatcgccaataataaatct
aatccaaattggatagcctatgatgtgctagctcaagctgagcatgatcctaatgctaag
acttatgttgtcagtacctctaaaaacttgcttgagaaagtaaaaaaagaaatttcttca
ttagtgcaaaattctaaaattcaaaatattgatcaatccatcaaaaatcattgtttttta
attctatctcaaggcaaaaaagagatttatgaaatttctaactttattgctcctgaacac
cttcacattcactcaaagttttctaaagatttattaaaaaatatcatccatgcaggatca
gtttttgttggagaaaaggcacctgttgctttgggggactatactattggcactaatcat
gttttaccaactgatcaaactgcaaaatttgcctctggactgagtgttgatgattttatg
aaaaagactgtctttattgatgtgggtgataaaactttgaagaaaatttctaaacccact
tctcatttagccagaaaagaaggtttagaagcacacgctttatcagttgaaattagaaaa
atcaaaacataa

DBGET integrated database retrieval system