KEGG   Alpha proteobacterium HIMB59: HIMB59_00008520Help
Entry
HIMB59_00008520   CDS       T02249                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:apc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HIMB59_00008520
  Amino acid metabolism
   00340 Histidine metabolism
    HIMB59_00008520
Enzymes [BR:apc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     HIMB59_00008520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
785959..787230
Genome map
AA seq 423 aa AA seqDB search
MKIVNKNWILSNLKSSLQTSSSVSSTVKSIIEDIKKNGDKALLKYVKKFENSKATIKNIK
LSKQDLKRAYNSISRQDKEALKLAYKRIHYYHTKQKKPSYSYKDQLDTKFYVQWNPIDNV
GLYIPGGMASYPSTVLMTSIPAKIAKVPNVMLCVPSKNGITSNLTLAAAYICGVDQVYNI
GGAQAIAAFAHGTKTIKKADKVFGPGNQFVAEAKKQLFGTIGIDLPAGPSEVLVIANNKS
NPNWIAYDVLAQAEHDPNAKTYVVSTSKNLLEKVKKEISSLVQNSKIQNIDQSIKNHCFL
ILSQGKKEIYEISNFIAPEHLHIHSKFSKDLLKNIIHAGSVFVGEKAPVALGDYTIGTNH
VLPTDQTAKFASGLSVDDFMKKTVFIDVGDKTLKKISKPTSHLARKEGLEAHALSVEIRK
IKT
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatagtcaataaaaattggattttatccaacttaaaatcatcccttcagacttca
tcttcagtttcttcaaccgtgaagtctattatcgaagacataaaaaaaaatggtgataaa
gcacttttaaaatatgttaaaaagtttgaaaattctaaagctacaattaaaaatataaaa
ttatcaaagcaagatttaaagagagcgtataattctatatcaagacaagataaagaagct
ttaaaattagcttataaaagaattcattactatcacaccaaacaaaagaaaccttcttat
tcttataaagatcaattagatactaagttttacgttcaatggaatcccatcgataatgtc
ggtctttatatccccgggggcatggcttcttatccctcaacagttttgatgacttcaatc
cctgctaaaatagcaaaagtacccaatgtgatgctttgcgttccatctaaaaatggaatt
acttccaatttaacattagctgcagcttatatttgtggtgttgatcaagtttataatatt
ggtggggcccaagctatagctgcttttgctcatggaacaaaaactataaaaaaagctgat
aaagtttttggtcctggtaaccagtttgtagcggaagcaaaaaaacaactttttggtacc
attggtatcgatctacctgcgggcccatcggaggtgcttgttatcgccaataataaatct
aatccaaattggatagcctatgatgtgctagctcaagctgagcatgatcctaatgctaag
acttatgttgtcagtacctctaaaaacttgcttgagaaagtaaaaaaagaaatttcttca
ttagtgcaaaattctaaaattcaaaatattgatcaatccatcaaaaatcattgtttttta
attctatctcaaggcaaaaaagagatttatgaaatttctaactttattgctcctgaacac
cttcacattcactcaaagttttctaaagatttattaaaaaatatcatccatgcaggatca
gtttttgttggagaaaaggcacctgttgctttgggggactatactattggcactaatcat
gttttaccaactgatcaaactgcaaaatttgcctctggactgagtgttgatgattttatg
aaaaagactgtctttattgatgtgggtgataaaactttgaagaaaatttctaaacccact
tctcatttagccagaaaagaaggtttagaagcacacgctttatcagttgaaattagaaaa
atcaaaacataa

DBGET integrated database retrieval system