KEGG   Alpha proteobacterium HIMB59: HIMB59_00009680Help
Entry
HIMB59_00009680   CDS       T02249                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:apc00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:apc00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
889710..891092
Genome map
AA seq 460 aa AA seqDB search
MNELKTLQTKGFKIVSNWQECNSKSIFFLNTLNLEDFDKYQKLAIKKKCTHIIANSSIKK
LNKMRNIKYYYINVQKDLFKIKKTFFDISKLKIIFLTGTNGKTSIAYGSHLLFSLNGIAS
CYLGTIGFFINGKKIKNLPNTTPSYLELSSLLYEAEKQKIKYAFIEASSIGFKEGRLGDL
KFDLCYLTNLQSDHLDYHKNIKNYHQSKIDMINLHSKTYSKLLIQDKNIKKNFSNFKNKN
KFLDDFIKYYKISIERKNFNSFSIKTGFKTYSINTINDFMIKNFISMLHIYFVFHEKLPQ
KINKKMFPDGRSQIIYNKNKKVILIDYAHTKEAFENLLSNLPKDIDHKIIIFGCGGDRDK
TKRTKMAKIASRYTDIQIITDDNPRNENPSDIRRILVESSSNPLEIPSRKKAIEKGVKLL
KTKKGLLIIAGKGHENIQIYKDKNFTFNDRLVAKSYAKYL
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaattaaaaacacttcaaactaagggatttaaaattgtatctaattggcaggag
tgtaattctaaatctattttctttttaaatacattaaatttagaagattttgataaatat
caaaaattagctatcaaaaaaaaatgtactcatataattgctaactcatctataaaaaaa
ctaaataaaatgagaaatattaagtattattacatcaatgttcaaaaagatttattcaaa
ataaaaaaaactttttttgacataagtaaattaaaaattattttcctaacaggtacaaat
ggaaaaacttccattgcatatggctcacatcttttattttctcttaatggaatagctagt
tgttatttaggtacaattggattctttattaatggtaaaaaaataaaaaatcttcccaat
acaacaccttcttatttagagttatcatccttactttatgaggctgaaaaacaaaaaata
aaatatgcatttatagaggcctctagtattggttttaaagagggaagactaggggatttg
aaatttgatctttgttatttaactaatcttcaatcagatcacttagattaccataaaaat
attaaaaattatcatcagtctaaaattgatatgattaatcttcattcaaaaacctattca
aagttattaattcaagataaaaatattaaaaaaaatttttcaaattttaaaaataaaaat
aaatttttagatgatttcataaaatattacaaaattagtatagaaagaaaaaattttaat
tctttttcaattaaaactggttttaaaacttattccattaacacaattaatgattttatg
attaaaaattttatatccatgttacatatttattttgtttttcatgaaaaattacctcaa
aaaataaataagaagatgtttcctgatggaagatcccagataatttataataaaaataaa
aaagttatattaatcgattatgcccatactaaagaggcttttgaaaatttattatctaat
cttccaaaagatatagaccataaaattattatttttggttgcggaggagatagggataaa
actaaaagaactaaaatggcaaagatagcatctagatatacagacatccaaataattact
gatgataaccctagaaacgaaaacccatcagatatcagaagaattcttgttgaatcttca
tcaaatccattagagataccatctagaaaaaaagcaattgaaaaaggtgttaaactttta
aaaacaaaaaaaggactattaataatagcaggcaaagggcatgaaaatattcagatttat
aaagataaaaattttacttttaatgatcgtcttgtagcgaaatcatatgcaaaatatctt
taa

DBGET integrated database retrieval system