KEGG   Alpha proteobacterium HIMB59: HIMB59_00010600Help
Entry
HIMB59_00010600   CDS       T02249                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:apc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HIMB59_00010600
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HIMB59_00010600
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HIMB59_00010600
Enzymes [BR:apc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HIMB59_00010600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(963917..965278)
Genome map
AA seq 453 aa AA seqDB search
MSEDSKFFLKDSDVPKQWYNLVADLKEPMSPPLHPGTKQPIGPDDLAPLFPMELIMQEVS
QDRYIDIPKPVQEAYSRWRCTPLVRARALEKALDTPARIYYKYEGASPSGSHKPNTALAQ
AFYNKEAGVKKIATETGAGQWGTALSYAGAVFGIEIQVFMVKVSFNQKPYRKAIIEGYGG
SVVASPSDLTNSGKAILEKDPNNSGSLGIAISEAVEVAATNDDTKYALGSVLNHVLMHQS
IIGQEALLQMEMADDYPDIVVGCTGGGSNFSGLCNPFLGKKFRGEQDVHAIAVEPSSCPS
LTKGTYSYDFGDTLKSTPLMKMHTLGSDFMPSPTHVGGLRYHGMAPVLSHLVHHGHVEPR
AYGQKECLEAGIQFARTEGIMPAPEATHAIKGAVDEALKCKAEGKSKSILFNLCGHGHFD
MQAYMDYFSGELAEDSFDAKAFEESLSAIPAVN
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggatagtaaattttttttaaaagacagtgatgtgccgaaacaatggtacaac
ctggtagcggatttaaaggagcctatgagtccccctttacatccaggaacaaaacaaccc
atcggcccagatgatttggctcctctttttcctatggagcttatcatgcaggaagtctca
caggatcgatatattgatataccaaagcctgttcaagaggcttatagccgttggagatgt
acaccattagttagagcaagagctttagaaaaagccttggatacccctgcaagaatatat
tacaaatatgaaggagctagtccttcaggtagccacaaacccaatacagcattagcacaa
gctttttataacaaagaagctggagttaaaaaaatagcaactgaaacaggtgctggtcag
tggggtactgctttgtcatatgcaggtgcagtatttggtatcgaaattcaagtatttatg
gtgaaggttagttttaaccagaaaccatacagaaaagcaattatagaaggctatggtgga
agtgttgtagccagcccttcagatttaactaattcaggaaaagcaatattagaaaaagat
cctaataattctggttcattaggtattgctatttctgaggcagttgaggttgcagctact
aatgatgatactaaatatgcgcttgggagtgttttaaatcacgtacttatgcatcaatcc
attattggacaagaggctttacttcaaatggaaatggctgatgattatcctgatatcgtc
gtaggctgtactggtggtggaagtaacttctcaggtctttgtaatccatttcttggtaag
aaatttagaggagaacaagatgttcatgcaatagctgtagaaccttcatcttgtccttct
ttaacaaaaggaacgtactcttatgattttggtgatactttaaagtctacgccgttaatg
aagatgcatacattaggatctgatttcatgccttctcctactcatgttggtggattgaga
tatcatgggatggccccggtattaagtcacttagttcatcatggccatgttgaacccaga
gcttatggtcaaaaagaatgcttagaagccggtattcaatttgcaagaacagaaggcatt
atgcctgcacctgaagctacacacgctattaaaggtgcggtggatgaagccttaaaatgt
aaagctgaaggaaaatcaaaatctatattatttaatctttgtggtcatggtcactttgat
atgcaagcatatatggattatttctccggcgagttagccgaagactccttcgatgctaaa
gcttttgaagagtccttatcggctattcctgcagttaattaa

DBGET integrated database retrieval system