KEGG   Alpha proteobacterium HIMB59: HIMB59_00010880Help
Entry
HIMB59_00010880   CDS       T02249                                 

Definition
glycosyl hydroalse family 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:apc00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:apc00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
988497..989504
Genome map
AA seq 335 aa AA seqDB search
MSFPLIISIKSSQISKFESENIRKYKPFGVILFKRNILNLNQTKKLIKSIKSLHPKIHIL
IDQEGGIVNRFPKLNEFNFLDNFDYYQTYLDYPSLAKQLVYLKSFITSYHLSEMGFDINT
IPVLDIPNSKTISMIKKRTFGSELDISIKLNEILVNTSISMGITPVMKHIPGHGLTSKDS
HLSLPKVNSSLKKLQNQLKLFQYFNHLPYAMTAHIKYEKWDKENMATYSKSIIQNIIRQQ
IRFKGQIMSDDMTMKANQYDIKESIIKCNQSGVDIFLDCSSDWGRYLEVIKSFKVTSRYK
NSLKIKKAKGKVDLKSINIIQYHDLYNELIKLYGI
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcccccttataatttcaatcaagtcttctcaaatttcaaaatttgagagtgaa
aatattagaaaatataaaccttttggtgttattctttttaaaagaaatattttaaattta
aatcagactaaaaaacttatcaaatctatcaaaagccttcatccaaaaatacatatttta
atagatcaagagggcggaatagtaaatcgttttccaaaattaaatgaatttaatttttta
gataattttgactattatcagacttatttagattatccttcgttagctaaacagttagta
tatttaaagtcttttattacaagttatcatttatctgaaatgggttttgacattaatact
attcccgttttggacatcccaaattcaaaaactatttctatgattaaaaagagaacattt
gggagtgaactagatatcagtattaaattgaatgaaattttagtaaatacttctatttct
atgggtattactccagttatgaagcatataccaggtcacggtctaacttcaaaagactca
catttatcactccctaaagtgaactcttcacttaaaaaattacaaaatcaattaaagcta
tttcagtatttcaatcatctcccatatgcgatgacagcgcatatcaaatacgaaaaatgg
gataaagaaaacatggcaacttattcaaagagcattatccaaaacattattcgtcaacaa
attaggtttaaaggtcaaatcatgagtgatgatatgacaatgaaggcaaatcaatacgat
ataaaagaaagcataattaagtgtaaccaatctggtgtggatatattcctggattgtagt
tctgattggggaagatatcttgaagtcattaaatctttcaaagtcaccagtcgatataaa
aattcattgaaaattaagaaagctaaagggaaagttgatcttaaatctattaatattatt
caatatcatgatttgtataatgaattaattaaactctatggaatctaa

DBGET integrated database retrieval system