KEGG   Alpha proteobacterium HIMB59: HIMB59_00012270Help
Entry
HIMB59_00012270   CDS       T02249                                 

Definition
Biotin-requring, e3 binding domain-containing, 2-oxoacid dehydrogenase family protein with acyltransferase activity
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
apc  Alpha proteobacterium HIMB59
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:apc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:apc00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:apc00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:apc00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1118822..1120114)
Genome map
AA seq 430 aa AA seqDB search
MFFEVNLPSLSPTMEEGKIVKWVKKEKDPILSGEVLFEVETDKATMEYESPEDGYIAKIL
TREGDIAKVNELVAIISDNKNVEESEIDKFINENNAHSAEVKNLSETKVTEVTTNNSSEK
ILITPLAKKIAKLKGINIENITPASRRIHLSDLNQITNKENSSSSDKFFISPFAKFLAKE
KSININEIKGTGPLNRIIGRDILNITNVSDNSKVNKLRQAIAKATIHSKQNIPHFYLNTK
VNMSNLLQFRKVQKQKGNKYSFNAILMQSIALAFDQFSDANCTYKDNGEFFINKDINIGI
AVDTNTGLKMPVLKNINSKDLSSINNGLNDLINITRENKISPSDLSGGVISISNLGSYNI
RSFDAIILPGQTYILAVGQIFEDVFVNKGKIEIASFVNLTLSCDHRAVDGVLASQFLSSI
VSNLEKINND
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgttttttgaagttaaccttccatctctttcgcctactatggaggagggaaagatagtg
aaatgggtaaaaaaagaaaaagatcctattttgagtggagaagttttatttgaagttgag
actgacaaggcaactatggagtatgaatctccagaggatggatacatagcaaaaattcta
acccgtgaaggtgatatcgctaaagtaaatgaactagtagcaataatatctgataataaa
aatgtagaagagagtgaaattgataaatttattaatgaaaataatgctcactcagctgaa
gtaaaaaatttatctgaaactaaggtcactgaagttacaacaaataattcttcagaaaaa
attttaataacacccttagctaaaaaaatagcaaaactaaaaggtattaatattgaaaat
ataactcctgcatctagaagaattcacttatcggacctaaatcaaattacaaataaagaa
aatagctcctcatctgataagttttttatttcaccctttgctaagtttctagcaaaagaa
aaatcaataaatatcaatgaaattaagggcacgggccccttgaatagaataattggcaga
gatatattaaatataactaacgtgtctgataattcaaaagtaaataaacttcgtcaagcc
attgctaaagcaacaatccattcaaagcaaaatattcctcatttttacttaaatactaaa
gtaaatatgagtaaccttttacaatttagaaaagttcaaaaacaaaaaggaaataaatat
tccttcaatgctatcttgatgcaatcaatagctttggcatttgatcaattttctgatgct
aattgcacatataaagacaatggtgaattttttattaacaaagatattaacataggtatc
gctgttgatactaatactggtctaaaaatgccagtcttaaaaaatattaattctaaagat
ctatcctcaattaataatggacttaatgatttaataaacatcacaagagaaaataaaatt
tctccatcagatttatctggaggtgtgattagtatttcaaatcttggctcttataatatt
agaagttttgatgcaattattttaccaggtcagacatacatacttgcagtgggtcaaata
ttcgaggatgtatttgttaataagggaaaaatagagatagctagttttgtaaatttaact
ttatcttgtgatcatagggctgtagatggcgttttagcctcacagttcctctctagtata
gtttcaaatttggagaaaataaataatgactaa

DBGET integrated database retrieval system